DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and Ccbe1

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_848908.1 Gene:Ccbe1 / 320924 MGIID:2445053 Length:408 Species:Mus musculus


Alignment Length:190 Identity:47/190 - (24%)
Similarity:62/190 - (32%) Gaps:72/190 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLWAVVEGHYYYDYGYWEINEPS----QLCSDYEMLVVNTR-----------QCVRRCNIVCLN 59
            |||.|:  ||   .:.|.|  ||.    ::||  |..:..|:           .|.|:   .|..
Mouse    25 LLLLAL--GH---TWTYRE--EPEDRDREVCS--ENKITTTKYPCLKSSGELTTCFRK---KCCK 77

  Fly    60 GVCFEDGSC-----------PCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAPDLCVCREDRHY 113
            |..|..|.|           || :|....|...::|.  |.||                     |
Mouse    78 GYKFVLGQCIPEDYDICAQAPC-EQQCTDNFGRVLCT--CYPG---------------------Y 118

  Fly   114 YFDPLSQKCRHRAPRL-LDPCLGR----CTH--GNCSSDGRCICAQGYELRDSLLHGQQC 166
            .:|....:.|.|...| :|.|...    |.|  .|......|.|.:||.|.|.   |:.|
Mouse   119 RYDRERHQKRERPYCLDIDECATSNTTLCAHICINTMGSYHCECREGYILEDD---GRTC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
Ccbe1NP_848908.1 EGF_CA 135..176 CDD:214542 13/44 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.