powered by:
Protein Alignment CG15861 and Dkk2
DIOPT Version :9
Sequence 1: | NP_001286863.1 |
Gene: | CG15861 / 37990 |
FlyBaseID: | FBgn0035084 |
Length: | 205 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099942.1 |
Gene: | Dkk2 / 295445 |
RGDID: | 1308639 |
Length: | 259 |
Species: | Rattus norvegicus |
Alignment Length: | 133 |
Identity: | 25/133 - (18%) |
Similarity: | 38/133 - (28%) |
Gaps: | 59/133 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 PCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAP----DLCVCREDRHYYFDPLSQKCRHRAPRL 129
||:.. .|| ..|.||.:| ..|:. ||.:..|
Rat 77 PCSSD------------KEC-----EVGRYCHSPHQGSSACMV--------------CRRKKKR- 109
Fly 130 LDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRHKQHH 194
|..|| :|..|....:.: |:|:.:....|. .|.|...||:..:
Rat 110 ------------CHRDG--MCCPGTRCNNGI-----CIPVTESILTPH----IPALDGTRHRDRN 151
Fly 195 YAH 197
:.|
Rat 152 HGH 154
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15861 | NP_001286863.1 |
None |
Dkk2 | NP_001099942.1 |
Dickkopf_N |
78..128 |
CDD:398399 |
16/100 (16%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1218 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.