DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and Dkk2

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:133 Identity:25/133 - (18%)
Similarity:38/133 - (28%) Gaps:59/133 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAP----DLCVCREDRHYYFDPLSQKCRHRAPRL 129
            ||:..            .||     ..|.||.:|    ..|:.              ||.:..| 
  Rat    77 PCSSD------------KEC-----EVGRYCHSPHQGSSACMV--------------CRRKKKR- 109

  Fly   130 LDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRHKQHH 194
                        |..||  :|..|....:.:     |:|:.:....|.    .|.|...||:..:
  Rat   110 ------------CHRDG--MCCPGTRCNNGI-----CIPVTESILTPH----IPALDGTRHRDRN 151

  Fly   195 YAH 197
            :.|
  Rat   152 HGH 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 16/100 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.