DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and NimB2

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:170 Identity:52/170 - (30%)
Similarity:68/170 - (40%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QCVRRCNIVCLNGVCFEDGSCPCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAPDLCVCREDRH 112
            :|:..|.:.|.||||.|...|.|.:.|.........|..||.|||  :.|.|.||:.|.|.:.  
  Fly   213 KCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYCQPECKPGC--SFGRCVAPNKCACLDG-- 273

  Fly   113 YYFDPLSQKCRHRAPRLLDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPR 177
                     .|..|....:|....|.:|.|::.|.|.|..|| |:   |.| :|.|||...| ..
  Fly   274 ---------YRLAADGSCEPVCDSCENGKCTAPGHCNCNAGY-LK---LQG-RCEPICSIPC-KN 323

  Fly   178 AYCFAPNLCACRH-------------KQHHYAHNGICSGN 204
            ..|..|::|.|..             |......||:|.||
  Fly   324 GRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGN 363



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.