DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and Dkk4

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:195 Identity:38/195 - (19%)
Similarity:53/195 - (27%) Gaps:81/195 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SQLCSDYEMLVVNTRQCVRRCNI--VCLNGVCFEDGSCPCADQYMAGNPDGLVCA---------- 85
            |..||....||::........::  .....:|..|..|......:|.:.:...||          
Mouse    10 SWFCSPLAALVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVRRRCQ 74

  Fly    86 --AECLPGCVAAGGYCAAPDLCVCREDRHYYFDPLSQKCRHRAPRLLDPCLGRCTHGNCSSDG-- 146
              |.|.||.|...      |:|...||..                   |.:.|.|.|   .||  
Mouse    75 RSAVCCPGTVCVN------DVCTAVEDTR-------------------PVMDRNTDG---QDGAY 111

  Fly   147 ---------------------RCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRH 190
                                 :...::|.|       |:.|:...|  ||       |.||..||
Mouse   112 AEGTTKWPAEENRPQGKPSTKKSQSSKGQE-------GESCLRTSD--CG-------PGLCCARH 160

  Fly   191  190
            Mouse   161  160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 12/55 (22%)
DKK-type Cys-1 41..90 12/54 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 7/51 (14%)
DKK-type Cys-2 145..218 9/25 (36%)
Prokineticin <145..202 CDD:148298 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.