DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and DKK1

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:181 Identity:38/181 - (20%)
Similarity:51/181 - (28%) Gaps:95/181 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 AGNPDGLVCAAECLPGCVAAGG------------------------YCAAP--------DLCV-C 107
            ||:|...|.||   ||.:..||                        |||:|        .:|: |
Human    53 AGHPGSAVSAA---PGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLAC 114

  Fly   108 REDRHYYFDPLSQKCRHRAPRLLDPCLGRCTHGNCSSDGRCICA--------------------- 151
            |:.|        ::|...|         .|..||...:|.|:.:                     
Human   115 RKRR--------KRCMRHA---------MCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDH 162

  Fly   152 ---QGYELRDSL---------LHGQQCMPICDHNCGPRAYCFAPNLCACRH 190
               .||..|.:|         ..|..|:...|        | |..||..||
Human   163 STLDGYSRRTTLSSKMYHTKGQEGSVCLRSSD--------C-ASGLCCARH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 14/70 (20%)
DKK-type Cys-1 85..138 14/69 (20%)
DKK-type Cys-2 189..263 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.