DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and MEGF6

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_011539187.1 Gene:MEGF6 / 1953 HGNCID:3232 Length:1603 Species:Homo sapiens


Alignment Length:191 Identity:48/191 - (25%)
Similarity:64/191 - (33%) Gaps:43/191 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RQCVRRCNIVCLNGVCFED-------GSCPCADQYMAGNPDGLVC---------AAECLPGCVAA 95
            |.||||......||.|...       ..|.|...|... .||..|         .|:|..||:..
Human   302 RHCVRRSPCANRNGSCMHRCQVVRGLARCECHVGYQLA-ADGKACEDVDECAAGLAQCAHGCLNT 365

  Fly    96 GGYCAAPDLCVCREDRHYYFDPLSQKCRHRAPRLLDPC---LGRCTHG--NCSSDGRCICAQGYE 155
            .|...    |||...  |......::|......:::.|   .|.|:||  :.|:...|.|.:|||
Human   366 QGSFK----CVCHAG--YELGADGRQCYRIEMEIVNSCEANNGGCSHGCSHTSAGPLCTCPRGYE 424

  Fly   156 LR---------DSLLHGQQCMPICDHN-----CGPRA-YCFAPNLCACRHKQHHYAHNGIC 201
            |.         |.......|..:|.:|     ||..| |..:.:.|.|.......:..|.|
Human   425 LDTDQRTCIDVDDCADSPCCQQVCTNNPGGYECGCYAGYRLSADGCGCEDVDECASSRGGC 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
MEGF6XP_011539187.1 EMI 108..176 CDD:284877
vWFA <215..261 CDD:294047
FXa_inhibition 268..304 CDD:291342 1/1 (100%)
vWFA <342..384 CDD:294047 11/47 (23%)
FXa_inhibition 397..432 CDD:291342 12/34 (35%)
vWFA <432..469 CDD:294047 8/36 (22%)
vWFA <472..511 CDD:294047 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.