DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and Stab1

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_619613.2 Gene:Stab1 / 192187 MGIID:2178742 Length:2571 Species:Mus musculus


Alignment Length:236 Identity:58/236 - (24%)
Similarity:80/236 - (33%) Gaps:85/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EINEPSQLCSDYEMLVVNTRQCVRRCNIVCLNGVCFE----DGSCPCADQYMAGN---------- 78
            |..:|::...|          |...||  |::|||..    ||||.|...|...:          
Mouse   150 ECRDPNRFGPD----------CQSVCN--CVHGVCSHGPRGDGSCRCFAGYTGPHCDQELPVCQS 202

  Fly    79 ---PDGLVCAAE-----CLPGCVAAGGYCAAPDLC-------------------VCREDRHYYFD 116
               |....|:||     ||||.......|.|||.|                   .|:...:|:.|
Mouse   203 LKCPQNSQCSAEAPTCKCLPGYTQQDNVCLAPDPCQPSACSPLARCSVTPQGQAQCQCPENYHGD 267

  Fly   117 PLSQKCRHRAPRLLDPCLGRCTHGNCSSD-----------GRCICAQGY-ELRDSLLHG--QQCM 167
              .:.|   .||  ||||  ...|.|.|:           ..|:|..|. .:.::...|  ..|.
Mouse   268 --GKVC---LPR--DPCL--TNFGGCPSNSTFCLYRGPGKATCMCRPGMTSINNNASEGCHVSCK 323

  Fly   168 PICDHNCGPRAYC-FAPN---LCACRHKQHHYAHNGICSGN 204
            |   |:|...|.| ..|:   .|.|::.:....|  .|.|:
Mouse   324 P---HSCDRSATCQVTPDRKTSCVCKNDEVGDGH--ACYGH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
Stab1NP_619613.2 Fasciclin 520..644 CDD:280607
EGF_3 915..946 CDD:289699
EGF_3 952..988 CDD:289699
Fasciclin 1000..1121 CDD:280607
EGF_3 1460..1496 CDD:289699
EGF_3 1502..1539 CDD:289699
EGF_3 1545..1582 CDD:289699
Fasciclin 1607..1711 CDD:280607
Fasciclin 1737..1867 CDD:280607
EGF_Lam <1992..2021 CDD:214543
EGF_3 2095..2130 CDD:289699
EGF_3 2136..2173 CDD:289699
Link_Domain 2208..2300 CDD:295393
FAS1 2367..2463 CDD:214719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.