powered by:
Protein Alignment CG15861 and dsl-5
DIOPT Version :9
Sequence 1: | NP_001286863.1 |
Gene: | CG15861 / 37990 |
FlyBaseID: | FBgn0035084 |
Length: | 205 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502191.1 |
Gene: | dsl-5 / 186492 |
WormBaseID: | WBGene00001107 |
Length: | 302 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 13/61 - (21%) |
Similarity: | 20/61 - (32%) |
Gaps: | 25/61 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 NCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRHKQHHYAHNGIC 201
:|:..|:..|..| |.|.:|..: ..|.||.|. :.|:|
Worm 162 HCNFQGKPSCLNG-------LTGSKCEKL-----------IVPKLCNCE-------NGGVC 197
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15861 | NP_001286863.1 |
None |
dsl-5 | NP_502191.1 |
DSL |
<131..180 |
CDD:279722 |
6/24 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1218 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.