DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and M03F4.6

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_508843.1 Gene:M03F4.6 / 180768 WormBaseID:WBGene00019759 Length:413 Species:Caenorhabditis elegans


Alignment Length:158 Identity:33/158 - (20%)
Similarity:49/158 - (31%) Gaps:40/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PCADQYMAGNPDGLVCAAECL--PGCVAAGGYCAAPDLCVCRED-RHYYFDPLSQKCRHRAPRLL 130
            |||.:         :..::||  ..|......| ....|.|..: ..|..|..:..||....::.
 Worm    25 PCAQK---------LIGSDCLFDEECYGMNSVC-RNSRCTCPTNFEEYDIDERTTICRLAPAKIG 79

  Fly   131 DPCLG------RCTHGNCSS------DGRCI--CAQGYELRDSLLHGQQCMPICDHN--CGPRAY 179
            |.|..      .|..|.|..      ||:|:  |..|.:     |:|.:|..:..:.  |...:.
 Worm    80 DSCQRDCKPPLLCRDGKCECWGGSIVDGKCVVLCPVGQQ-----LYGVECTRVAHYQQPCEKDSQ 139

  Fly   180 CFAP------NLCACRHKQHHYAHNGIC 201
            |..|      ..|.|..........|.|
 Worm   140 CVDPFNACIAGTCLCAPGTTRDTERGFC 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
M03F4.6NP_508843.1 EB 113..160 CDD:279949 10/51 (20%)
EB 272..321 CDD:279949
EB 331..381 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.