Sequence 1: | NP_001286863.1 | Gene: | CG15861 / 37990 | FlyBaseID: | FBgn0035084 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741140.1 | Gene: | pqn-25 / 175759 | WormBaseID: | WBGene00004114 | Length: | 672 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 78/206 - (37%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 HYYYDYGYWEINEPSQLCSDYEMLVVNTRQCV------RRC--NIVCLNGVCFEDGSCPCADQYM 75
Fly 76 AGNPDGLVCAAECLPGCVAAGGYCAAPDLCVCREDR----HYYFDPL--------SQKCRHRAPR 128
Fly 129 LLDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRHKQH 193
Fly 194 HYAHNGICSGN 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15861 | NP_001286863.1 | None | |||
pqn-25 | NP_741140.1 | EB | 160..211 | CDD:279949 | |
EB | 219..270 | CDD:279949 | 3/7 (43%) | ||
EB | 278..329 | CDD:279949 | 17/70 (24%) | ||
EB | 341..>376 | CDD:279949 | 4/34 (12%) | ||
EB | 384..435 | CDD:279949 | 16/58 (28%) | ||
EB | 450..496 | CDD:279949 | |||
EB | 504..555 | CDD:279949 | |||
EB | 563..614 | CDD:279949 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |