DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and pqn-25

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_741140.1 Gene:pqn-25 / 175759 WormBaseID:WBGene00004114 Length:672 Species:Caenorhabditis elegans


Alignment Length:206 Identity:49/206 - (23%)
Similarity:78/206 - (37%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HYYYDYGYWEINEPSQLCSDYEMLVVNTRQCV------RRC--NIVCLNGVCFEDGSCPCADQYM 75
            :|...|||. :...|.:|...:.||.|  |||      ..|  |..|:.|.....|:|.|.:   
 Worm   262 NYRLVYGYC-VPITSSICQQTQTLVNN--QCVLLSIVGETCIANQQCVGGAMCNSGTCQCTN--- 320

  Fly    76 AGNPDGLVCAAECLPGCVAAGGYCAAPDLCVCREDR----HYYFDPL--------SQKCRHRAPR 128
                           |..|..|||.:.....|..::    ...::.:        ||:|.:.|..
 Worm   321 ---------------GATAMYGYCISSSSSSCNSNQVSINGMCYNTVQVGGSCSFSQQCLNNAVC 370

  Fly   129 LLDPCLGRCTHGNCSSDGRCICAQGYELRDSLLHGQQCMPICDHNCGPRAYCFAPNLCACRHKQH 193
            ..:.|:......:||::..||..|.|   :.:..|.||  :....|...:.|.: ::|.|  .|.
 Worm   371 TNNICVSTFCSVSCSTNQVCISNQCY---NYVSIGSQC--VGSQQCLSNSQCIS-SICQC--PQG 427

  Fly   194 HYAHNGICSGN 204
            ....||:|:||
 Worm   428 TQQSNGVCTGN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
pqn-25NP_741140.1 EB 160..211 CDD:279949
EB 219..270 CDD:279949 3/7 (43%)
EB 278..329 CDD:279949 17/70 (24%)
EB 341..>376 CDD:279949 4/34 (12%)
EB 384..435 CDD:279949 16/58 (28%)
EB 450..496 CDD:279949
EB 504..555 CDD:279949
EB 563..614 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.