DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and F07H5.8

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_495874.3 Gene:F07H5.8 / 174407 WormBaseID:WBGene00008559 Length:835 Species:Caenorhabditis elegans


Alignment Length:174 Identity:37/174 - (21%)
Similarity:52/174 - (29%) Gaps:67/174 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CVRRCNIVCLNGVCFEDGSCPCADQYMAGNPDGL------------VCAAECLPGCVAAGGYCAA 101
            |:..|...|         ...|..||::....|:            :|...|.|||||......|
 Worm   319 CIPACQPAC---------QPQCVYQYLSSGSSGISTVPPVTKVCISICQPACDPGCVAIYTTTPA 374

  Fly   102 PDLCVCREDRHYYFDPLSQKCRHRAPRLLDPCLGRCTH-------------GNC--SSDGRCICA 151
            |..||             .:|:       ..||..||.             ..|  :.:.:||.|
 Worm   375 PLHCV-------------SQCQ-------PACLPSCTDTFTTTISLPKQCVPECQPACETKCIVA 419

  Fly   152 Q-GYELRDSLLHGQQ----------CMPICDHNCGPRAYCFAPN 184
            | ..::::|....||          |:|.|...|........||
 Worm   420 QIVLKIKNSYQQPQQLSQQYIPQSSCVPQCQPACTQECVAAQPN 463



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.