DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15861 and Dkk1

DIOPT Version :9

Sequence 1:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:231 Identity:41/231 - (17%)
Similarity:59/231 - (25%) Gaps:126/231 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GVCFEDGS----------CPCADQYMAGNPDGLVCAAECLPGCVAAGGYCAAP----------DL 104
            ||.:|.|:          .|||:....|:.:                 ||::|          .:
Mouse    66 GVLYEGGNKYQTLDNYQPYPCAEDEECGSDE-----------------YCSSPSRGAAGVGGVQI 113

  Fly   105 CV-CREDRHYYFDPLSQKCRHRAPRLLDPCLGRCTHGNCSSDGRCI------------------- 149
            |: ||:.|        ::|...|         .|..||...:|.|:                   
Mouse   114 CLACRKRR--------KRCMRHA---------MCCPGNYCKNGICMPSDHSHFPRGEIEESIIEN 161

  Fly   150 --------CAQGYELRDSL------LHGQQ------------------------CMP------IC 170
                    ...||..|.:|      ..||:                        |.|      :|
Mouse   162 LGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVC 226

  Fly   171 -------DHNCGPRAYCFAPNLCACR-HKQHHYAHN 198
                   .|.......|:.....||| .|.||.|.|
Mouse   227 TKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15861NP_001286863.1 None
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 16/89 (18%)
DKK-type Cys-1 86..141 16/88 (18%)
DKK-type Cys-2 195..269 13/68 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.