powered by:
Protein Alignment CG15861 and ESM1
DIOPT Version :9
Sequence 1: | NP_001286863.1 |
Gene: | CG15861 / 37990 |
FlyBaseID: | FBgn0035084 |
Length: | 205 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_008967.1 |
Gene: | ESM1 / 11082 |
HGNCID: | 3466 |
Length: | 184 |
Species: | Homo sapiens |
Alignment Length: | 105 |
Identity: | 22/105 - (20%) |
Similarity: | 27/105 - (25%) |
Gaps: | 46/105 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 133 CLGRCTHGNCSSDGRC------------ICAQGYELRDSLLHGQQCMPICD----HNCGPRAYCF 181
|...|....|.|..|| :||.| .|:.|..... ..|||...|.
Human 28 CPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG--------RGETCYRTVSGMDGMKCGPGLRCQ 84
Fly 182 APN----------LCA----------CRHKQHHYAHNGIC 201
..| :|. ||...: ..:|||
Human 85 PSNGEDPFGEEFGICKDCPYGTFGMDCRETCN--CQSGIC 122
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15861 | NP_001286863.1 |
None |
ESM1 | NP_008967.1 |
IB |
26..100 |
CDD:197525 |
16/79 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1218 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.