DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and GGACT

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001182016.1 Gene:GGACT / 87769 HGNCID:25100 Length:153 Species:Homo sapiens


Alignment Length:143 Identity:54/143 - (37%)
Similarity:76/143 - (53%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGYYVTG 75
            ::.:||||.||.|||::.:|....:|.|.|..:..|.:..|||||..:|||:||:.||.|..|.|
Human     1 MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEG 65

  Fly    76 EIYEVDDRMLNSLDNLEDCEEIYTRE------MHDMNIGVGEGTVP----CWVYLLQKYPENLLS 130
            |:|.||:|||..||:.|.|..:|.|.      :.|...|..|...|    |:||....:|.....
Human    66 EVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQ 130

  Fly   131 LRYLSSYENSTTH 143
            |.:..||::...|
Human   131 LPHHDSYDSEGPH 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 50/125 (40%)
GGACTNP_001182016.1 GGACT 4..138 CDD:399234 52/133 (39%)
Substrate binding 7..10 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..153 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145099
Domainoid 1 1.000 94 1.000 Domainoid score I7493
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5043
Isobase 1 0.950 - 0 Normalized mean entropy S4571
OMA 1 1.010 - - QHG45924
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - otm40970
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4010
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.