DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and AT5G46720

DIOPT Version :10

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_199484.1 Gene:AT5G46720 / 834715 AraportID:AT5G46720 Length:175 Species:Arabidopsis thaliana


Alignment Length:135 Identity:43/135 - (31%)
Similarity:59/135 - (43%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQAKKVSSALSKLFVYGALKYGQPSNSILAS--SGNGFAKFWCKATTTQKLPLVIATRYNIPFL 63
            ||.:.|     :.:||||.||....::.:|..  |.|. |.:..:.||..:.|||... |.||:|
plant     1 MGGSNK-----NLIFVYGTLKRNHRNHFLLEDLISTND-AVYIGQRTTRLQYPLVTGL-YGIPYL 58

  Fly    64 LNKPGVGYYVTGEIYEVDDRMLNSLDNL-----------------EDCEE-----IYTREMHDMN 106
            :||.|.|..:.||:|.|..|.|..||.|                 ||.||     :...|.:..:
plant    59 INKSGSGQKIRGELYSVSKRGLVRLDELEGIKVNHYERLPIEVIEEDDEEEESNGVVLAEAYFAH 123

  Fly   107 IGVGE 111
            .|.||
plant   124 FGFGE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..131 CDD:428763 40/122 (33%)
AT5G46720NP_199484.1 YtfP 7..>96 CDD:441708 32/90 (36%)

Return to query results.
Submit another query.