DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and AT5G46720

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_199484.1 Gene:AT5G46720 / 834715 AraportID:AT5G46720 Length:175 Species:Arabidopsis thaliana


Alignment Length:135 Identity:43/135 - (31%)
Similarity:59/135 - (43%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQAKKVSSALSKLFVYGALKYGQPSNSILAS--SGNGFAKFWCKATTTQKLPLVIATRYNIPFL 63
            ||.:.|     :.:||||.||....::.:|..  |.|. |.:..:.||..:.|||... |.||:|
plant     1 MGGSNK-----NLIFVYGTLKRNHRNHFLLEDLISTND-AVYIGQRTTRLQYPLVTGL-YGIPYL 58

  Fly    64 LNKPGVGYYVTGEIYEVDDRMLNSLDNL-----------------EDCEE-----IYTREMHDMN 106
            :||.|.|..:.||:|.|..|.|..||.|                 ||.||     :...|.:..:
plant    59 INKSGSGQKIRGELYSVSKRGLVRLDELEGIKVNHYERLPIEVIEEDDEEEESNGVVLAEAYFAH 123

  Fly   107 IGVGE 111
            .|.||
plant   124 FGFGE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 40/122 (33%)
AT5G46720NP_199484.1 GGACT 9..>96 CDD:377602 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3353
eggNOG 1 0.900 - - E1_COG2105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2510
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - mtm945
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.