DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and AT3G02910

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_566187.1 Gene:AT3G02910 / 821189 AraportID:AT3G02910 Length:187 Species:Arabidopsis thaliana


Alignment Length:170 Identity:56/170 - (32%)
Similarity:72/170 - (42%) Gaps:21/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQAKKVSSALSKLFVYGALKYGQPSNSILASS--GNGFAKFWCKATTTQKLPLVIATRYNIPFL 63
            ||......:..:.:|.||.||.|. ||.:|...  .:|.|.|.....|..|.|||... |.:|||
plant     1 MGHETMTPATTTLVFTYGTLKRGF-SNHVLMQDLIRSGDASFKGVYQTLDKYPLVCGP-YRVPFL 63

  Fly    64 LNKPGVGYYVTGEIYEVDDRMLNSLDNLEDCE---------EIYTREMHDMNIGVGEGTVP--CW 117
            |||||.||:|.||:|.|..|.|:.||.||...         .:...|..:...|..|...|  |.
plant    64 LNKPGSGYHVNGELYAVSPRGLSRLDELEGISRGHYIRQPIRLAAAEEEEEEEGDLETEAPSSCV 128

  Fly   118 V---YLLQKYPENLLSL---RYLSSYENSTTHPYIMRHRR 151
            |   |..:.|.|.|...   |...:|..:....|:.|:.|
plant   129 VEAYYAHKSYEEELWRRNRGRSFGAYTENEARGYVKRNDR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 49/131 (37%)
AT3G02910NP_566187.1 GGACT 14..>106 CDD:283699 39/93 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3353
eggNOG 1 0.900 - - E1_COG2105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2510
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - mtm945
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.