DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and ggact.1

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001071185.1 Gene:ggact.1 / 777609 ZFINID:ZDB-GENE-061103-94 Length:161 Species:Danio rerio


Alignment Length:126 Identity:50/126 - (39%)
Similarity:69/126 - (54%) Gaps:1/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGYYVTGEIY 78
            :||||.||.||.:...|.::.:|.|:|...|.|....|:||||:...|||||.||.|..|.||||
Zfish    23 VFVYGTLKKGQSNYHELTNTTHGQAEFITCARTKDPYPMVIATKDKFPFLLNVPGSGQQVYGEIY 87

  Fly    79 EVDDRMLNSLDNLEDCEEIYTREMHDMNIGVGEG-TVPCWVYLLQKYPENLLSLRYLSSYE 138
            .||..||:.||..|:|.::|.|....:.|..|.| :...:||....:..:.|:....|.|:
Zfish    88 NVDQNMLDFLDEFEECPDLYQRTSIQLKILKGNGDSEEAFVYSTSTFDPDWLNKPTFSVYD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 47/116 (41%)
ggact.1NP_001071185.1 GGACT 23..129 CDD:283699 45/105 (43%)
Substrate binding. /evidence=ECO:0000250 26..29 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4932
OMA 1 1.010 - - QHG45924
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - mtm6526
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4010
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.