DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and ggact.2

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001004544.1 Gene:ggact.2 / 447805 ZFINID:ZDB-GENE-040912-8 Length:191 Species:Danio rerio


Alignment Length:152 Identity:62/152 - (40%)
Similarity:81/152 - (53%) Gaps:11/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGYYVTGEIY 78
            :||||.||.|||:...|..|.||.|:|...|.|.:..||||....|||||||.||.|..|.||||
Zfish     4 VFVYGTLKKGQPNYFRLIDSSNGQAEFITCARTVEPYPLVITGECNIPFLLNVPGSGQRVYGEIY 68

  Fly    79 EVDDRMLNSLDNLEDCEEIYTREMHDMNI--GVGEGTV-PCWVYLLQKYPENLLSLRYLSSYENS 140
            .||.:||..||..|:|.:.|.|.:..:.|  |.||..| ..:||...||..:.|:.....||:::
Zfish    69 SVDQKMLEFLDWFEECPDWYQRTLIQLEILKGNGETEVEEAFVYTKTKYEPDWLNKPTYDSYDSN 133

  Fly   141 TTHPYIMRHRRTHKHPAQDDLT 162
            ..|..        |:..::|:|
Zfish   134 GDHGL--------KYAYEEDMT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 55/118 (47%)
ggact.2NP_001004544.1 GGACT 4..112 CDD:283699 51/107 (48%)
Substrate binding. /evidence=ECO:0000250 7..10 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4932
OMA 1 1.010 - - QHG45924
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - mtm6526
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4010
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.