DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and CG2811

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001246514.1 Gene:CG2811 / 37988 FlyBaseID:FBgn0035082 Length:157 Species:Drosophila melanogaster


Alignment Length:161 Identity:66/161 - (40%)
Similarity:97/161 - (60%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AKKVSSALSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPG 68
            |:|:..| :::||||.||.|:|::..|....||.|:|..:..|..|.|||:.|||||||||.:||
  Fly     2 AEKLRMA-ARVFVYGTLKRGEPNHHWLTKKENGQARFLGRGKTETKFPLVVGTRYNIPFLLARPG 65

  Fly    69 VGYYVTGEIYEVDDRMLNSLDNLEDCEEIYTREMHDMNIGVGEGTVPCWVYLLQKYPENLLSLRY 133
            .|.::.||:||||:.||:.||.|||..:.|.||...:.:...| |:.||:||::.:|:.:|:...
  Fly    66 EGNHIEGEVYEVDETMLSKLDILEDYPDYYDREQQTILMEQNE-TIQCWLYLIRNFPDKMLAKEL 129

  Fly   134 LSSYENSTTHPYIMRHRRTHKHPAQDDLTYE 164
            |.||.|:...||    ...:.....:||..|
  Fly   130 LISYHNTPERPY----NENYLDSCPEDLAME 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 53/115 (46%)
CG2811NP_001246514.1 GGACT 11..122 CDD:283699 52/111 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445831
Domainoid 1 1.000 71 1.000 Domainoid score I3353
eggNOG 1 0.900 - - E1_COG2105
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I2510
Isobase 1 0.950 - 0 Normalized mean entropy S4571
OMA 1 1.010 - - QHG45924
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - mtm6526
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - P PTHR12510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4010
SonicParanoid 1 1.000 - - X2213
1413.790

Return to query results.
Submit another query.