DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and ggact

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_002937126.2 Gene:ggact / 100379707 XenbaseID:XB-GENE-961428 Length:160 Species:Xenopus tropicalis


Alignment Length:155 Identity:59/155 - (38%)
Similarity:80/155 - (51%) Gaps:16/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGYYVTG 75
            ::.:||||.||.|||:::::....:|.|.|.....|.:|.|||||...|||||||.||.|..:.|
 Frog     4 MTNIFVYGTLKRGQPNHTVMTCYKHGKAVFKGMGKTVEKYPLVIAEEANIPFLLNIPGTGRRIIG 68

  Fly    76 EIYEVDDRMLNSLDNLEDCEEIYTREMHDMNIGVGEGT-------------VPCWVYLLQKYPEN 127
            |||.|||.||..||:.|.|...|.|....:.|...:||             :.|::|....|..:
 Frog    69 EIYSVDDSMLQFLDDFEGCPNWYQRTSQGIEILEWDGTDDSPEERPAVKSIITCFLYSTTCYQPH 133

  Fly   128 LLSLRYLSSYENSTTH--PYIMRHR 150
            .|.|.|...|:....|  || ::||
 Frog   134 WLQLPYHKCYDTFGNHGLPY-LKHR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 50/128 (39%)
ggactXP_002937126.2 GGACT 7..>100 CDD:399234 44/92 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6909
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4862
OMA 1 1.010 - - QHG45924
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - otm48165
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4010
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.