DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tina-1 and ggact.3

DIOPT Version :9

Sequence 1:NP_611983.2 Gene:Tina-1 / 37989 FlyBaseID:FBgn0035083 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_005168352.1 Gene:ggact.3 / 100038780 ZFINID:ZDB-GENE-070424-26 Length:187 Species:Danio rerio


Alignment Length:160 Identity:63/160 - (39%)
Similarity:85/160 - (53%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VSSALSKLFVYGALKYGQPSNSILASSGNGFAKFWCKATTTQKLPLVIATRYNIPFLLNKPGVGY 71
            ||.:...:||||:||.|||::..|.:|.||.|:|...|.|.:..||||||::|||||||.||.|.
Zfish    34 VSMSTHHVFVYGSLKKGQPNHHELLNSNNGQAEFITCAQTKEPYPLVIATKHNIPFLLNVPGSGK 98

  Fly    72 YVTGEIYEVDDRMLNSLDNLEDCEEIYTREMHDMNIGVGEG----TVPCWVYLLQKYPENLLSLR 132
            .|:||||.||.:||..||..|.|.:.|.|....:.|..|.|    .....||....:..:.|:..
Zfish    99 QVSGEIYSVDQKMLEFLDWFEKCPDWYQRTSIQLEILKGNGESGRIEEASVYSKINFEPDWLNKP 163

  Fly   133 YLSSYENSTTH--PYIMRHRRTHKHPAQDD 160
            ...||:.:..|  .::.|..|      :||
Zfish   164 THESYDTNGDHGLKFVCREDR------KDD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tina-1NP_611983.2 GGACT 14..130 CDD:399234 53/119 (45%)
ggact.3XP_005168352.1 GGACT 41..150 CDD:283699 51/108 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578414
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2105
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4932
OMA 1 1.010 - - QHG45924
OrthoDB 1 1.010 - - D1389682at2759
OrthoFinder 1 1.000 - - FOG0002855
OrthoInspector 1 1.000 - - mtm6526
orthoMCL 1 0.900 - - OOG6_103544
Panther 1 1.100 - - O PTHR12510
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4010
SonicParanoid 1 1.000 - - X2213
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.