DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3760 and CDV3

DIOPT Version :9

Sequence 1:NP_726501.1 Gene:CG3760 / 37987 FlyBaseID:FBgn0022343 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005247645.1 Gene:CDV3 / 55573 HGNCID:26928 Length:259 Species:Homo sapiens


Alignment Length:294 Identity:84/294 - (28%)
Similarity:123/294 - (41%) Gaps:64/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAE-----LDDFFAKKDKKKSKNKTKFVTADEMVKNLEDGTKREVVKPKKPEVAAGGVAVVGENE 60
            |||     ||:||||:||||.|.::....:.........|:....       .||||.|..|...
Human     1 MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAA-------GAAGGGAGAGTRP 58

  Fly    61 -NSGTKVPESAPP---------VEEEWKEFEEEQRKDYSGLKIGQLSTISSARSRTAQESSESQA 115
             :.||....:|.|         .|:||||.|::: .|||||:: |...|||.:     |..:::.
Human    59 GDGGTASAGAAGPGAATKAVTKDEDEWKELEQKE-VDYSGLRV-QAMQISSEK-----EEDDNEK 116

  Fly   116 ARVPSAPDGGNYNEDDEDSNGYDNADVNKERVGHGPWKKVVPAEEVMQIPVPVEVEKHSSKTYVS 180
            .:.|    |.|:.|......|.:.:.        |||.|..|   |...|.||.|.:.......|
Human   117 RQDP----GDNWEEGGGGGGGMEKSS--------GPWNKTAP---VQAPPAPVIVTETPEPAMTS 166

  Fly   181 PALRYSQQAGSGLGGGPTGGALRPRR----AAPDITNTEFFPTL-SAARPEEQRK--KKNEPAFE 238
            ...|            |.|..|...|    ..|:|.:...||:| |.|:..|.|.  |:.|.:||
Human   167 GVYR------------PPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRDKEMEKSFE 219

  Fly   239 EVRHGSRFQ-RVQESTAAPVAASNRFQSLDDEAS 271
            .|||.:|.: .|.::.|..:...|::..|:::.|
Human   220 VVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3760NP_726501.1 CDV3 86..223 CDD:292003 37/141 (26%)
CDV3XP_005247645.1 CDV3 81..201 CDD:292003 42/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49391
OrthoDB 1 1.010 - - D1568537at2759
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108335
Panther 1 1.100 - - LDO PTHR16284
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.