DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3760 and LOC499235

DIOPT Version :9

Sequence 1:NP_726501.1 Gene:CG3760 / 37987 FlyBaseID:FBgn0022343 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_574528.1 Gene:LOC499235 / 499235 RGDID:1565730 Length:159 Species:Rattus norvegicus


Alignment Length:159 Identity:43/159 - (27%)
Similarity:62/159 - (38%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PSAPDGGNYNEDDEDSNGYDNADVNKERVGHGPWKKVVPAEEVMQIPVPVEVEKHSSKTYVSPAL 183
            |||.| ..|.:..|......|...:......|||.|..   .|...|.||.|.:.......|...
  Rat     9 PSAHD-NQYTKYTEQRKNIKNLQGSGAEKSSGPWNKTA---LVQAPPAPVTVTETPEPAMPSGVY 69

  Fly   184 RYSQQAGSGLGGGPTGGALRPRR----AAPDITNTEFFPTL-SAARPEEQRK--KKNEPAFEEVR 241
            |            |.|..|...|    ..|:|.:...||:| |.|:..|.|.  |:.|.:||.||
  Rat    70 R------------PPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRNRDKEMEKSFEVVR 122

  Fly   242 HGSRF-QRVQESTAAPVAASNRFQSLDDE 269
            |.:|. :.|.::.|..:...|::..|:::
  Rat   123 HKNRVREEVSKNQALKLELDNQYAVLENQ 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3760NP_726501.1 CDV3 86..223 CDD:292003 28/108 (26%)
LOC499235XP_574528.1 CDV3 <30..101 CDD:292003 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1568537at2759
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108335
Panther 1 1.100 - - O PTHR16284
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.970

Return to query results.
Submit another query.