DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3760 and cdv3

DIOPT Version :9

Sequence 1:NP_726501.1 Gene:CG3760 / 37987 FlyBaseID:FBgn0022343 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_012819977.1 Gene:cdv3 / 448377 XenbaseID:XB-GENE-5805319 Length:245 Species:Xenopus tropicalis


Alignment Length:286 Identity:85/286 - (29%)
Similarity:123/286 - (43%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAE-----LDDFFAKKDKKKSKNKTKFVTADEMVKNLEDGTKREVVKPKKPEVAAGGVAVVG--- 57
            |||     |||||||:||||.|:|...|:|    ......|:.....|.....:|..::..|   
 Frog     1 MAEPEGRSLDDFFAKRDKKKKKDKGGPVSA----AGSRGATRPPDGAPSSFSSSASSMSGAGKGI 61

  Fly    58 ENENSG-TKVPESAPPVE-EEWKEFEEEQRKDYSGLKIGQLSTISSARSRTAQESSESQAARVPS 120
            :.|.|| ::.|:.....| :||||||::: .|||||:|..|...|:.:.....|..|.|.|    
 Frog    62 KKEKSGKSENPDQLQEKEDDEWKEFEQKE-VDYSGLRIQSLQISSNEKDDDEYEKKEEQGA---- 121

  Fly   121 APDGGNYNEDDEDSNGYDNADVNKERVGHGPWKKV----VPAEEVMQIPVPVEVEKHSSKTYVSP 181
                     |.||..|   ...:|   ..|||.|.    .|...|::.|.||    |:...|..|
 Frog   122 ---------DWEDIGG---CGTDK---SSGPWNKTAQAQAPISAVIEAPEPV----HTGGVYRPP 167

  Fly   182 ALRYSQQAGSGLGGGPTGGALRPRRAAPDITNTEFFPTLSAARP--EEQRKKKNEPAFEEVRHGS 244
            |.|.|.             |.|..:..|:|.:...||:|.|...  |.:|.|:.|..||.|:|.:
 Frog   168 AARASV-------------ATRKPQGPPEIFSDTQFPSLQATAKHIESRRDKEMEKTFEVVKHKN 219

  Fly   245 RFQ-RVQESTAAPVAASNRFQSLDDE 269
            |.: ...::.|..:...|::..|.::
 Frog   220 RARDEAAKNQALRLQLDNQYAVLGEQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3760NP_726501.1 CDV3 86..223 CDD:292003 39/140 (28%)
cdv3XP_012819977.1 CDV3 79..196 CDD:373782 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5073
OMA 1 1.010 - - QHG49391
OrthoDB 1 1.010 - - D1568537at2759
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16284
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.