DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3760 and CG4892

DIOPT Version :9

Sequence 1:NP_726501.1 Gene:CG3760 / 37987 FlyBaseID:FBgn0022343 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609778.3 Gene:CG4892 / 34949 FlyBaseID:FBgn0028884 Length:238 Species:Drosophila melanogaster


Alignment Length:255 Identity:79/255 - (30%)
Similarity:116/255 - (45%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAELDDFFAKKDKKKS-KNKTKFVTADEMVKNLEDGTK----REVVKPKKPEVAAGGVAVVGENE 60
            ||.|||||||||.||: |.|..::..||:.|.||:..|    .:.||..:.|     ....|..|
  Fly     1 MASLDDFFAKKDNKKTKKKKPNYLATDELYKTLEESAKLATDADSVKSMENE-----NRTEGPTE 60

  Fly    61 NSGTKV---------PESAPPVEEEWKEFEEEQRKDYSGLKIGQLSTI---SSARSRTAQESSES 113
            ::|:.:         |..:...|:||.||.||.|.:...|.....|||   .:.....||:|.::
  Fly    61 STGSAMKSLEFSLLYPNESVKEEDEWSEFTEENRMELMSLGHSSGSTILTQLAVGDVKAQDSEQT 125

  Fly   114 QAARVPSAPDGGNYNEDDEDSNGYDNADVNKERVGHGPWKKVVPAEEVMQIPVPVEVEKHS---- 174
            .     :..||.|..:..:|..|....          ||.|:..|.|..::..|:.||:.:    
  Fly   126 D-----TGGDGMNVGQKHDDDIGNTTC----------PWVKMEHALEQQKLKEPMSVEQPNKKEP 175

  Fly   175 ----SKTYVSPALRYSQ-------QAGSGLGGGPTGGALRPRRAAPDITNTEFFPTLSAA 223
                |:.|:.||||.||       ||.|.|...|:..:.:|:  |||:.:.|:||:||.|
  Fly   176 SEVKSQIYIPPALRQSQGDFNRRDQAESRLRKVPSKMSGKPQ--APDLNSDEYFPSLSKA 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3760NP_726501.1 CDV3 86..223 CDD:292003 42/154 (27%)
CG4892NP_609778.3 CDV3 82..233 CDD:405941 50/167 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16284
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.