DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3760 and cdv3

DIOPT Version :9

Sequence 1:NP_726501.1 Gene:CG3760 / 37987 FlyBaseID:FBgn0022343 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_005162619.1 Gene:cdv3 / 334102 ZFINID:ZDB-GENE-030131-6034 Length:237 Species:Danio rerio


Alignment Length:292 Identity:76/292 - (26%)
Similarity:114/292 - (39%) Gaps:93/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDDFFAKKDKKKSKNKTKFVTADEMVKNLEDGTKREVVKPKKPEVAAGGVAVVGENENSGTKVPE 68
            |||||||:||||.|.|.|   ..|.|..........|.|.||.:..:      .::||...::.:
Zfish    13 LDDFFAKRDKKKKKEKGK---GKEQVTGAAAAAAMPVKKMKKEKEKS------TKSENQDAQMEK 68

  Fly    69 SAPPVEEEWKEFEEEQRKDYSGLKIGQLSTISSARSRTAQESSESQAARVPSAPDGGNYNEDDED 133
            .    :|||||||::: .||:||::                    ||.::          .|:::
Zfish    69 E----DEEWKEFEQKE-VDYTGLRL--------------------QAMQM----------SDEKE 98

  Fly   134 SNGYDNADVNKERVGH-------------GPWKK---------VVPAEEVMQIPVPVEVEKHSSK 176
            ...|:     ||.||.             |||.|         ..|.||| ::|.|     .:..
Zfish    99 EEEYE-----KEEVGEDGEIILVTSDKMSGPWNKSGGAPPSAASAPVEEV-EVPEP-----KAPG 152

  Fly   177 TYVSPALRYSQQAGSGLGGGPTGGALRPRRAAPDITNTEFFPT-LSAARPEE--QRKKKNEPAFE 238
            .|..|..|.            |.....|.:..|:|.:...||: ||.||..|  .|.::.|..||
Zfish   153 VYRPPGARL------------TTTKKAPAQGPPEIFSDAQFPSLLSTARHVETRNRDREMEKTFE 205

  Fly   239 EVRHGSRFQRVQ-ESTAAPVAASNRFQSLDDE 269
            .|:|.||.:..: ..:...:...|::..|.|:
Zfish   206 VVKHKSRVREGEGPGSMQQLQLDNQYAILGDK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3760NP_726501.1 CDV3 86..223 CDD:292003 33/159 (21%)
cdv3XP_005162619.1 CDV3 69..187 CDD:292003 39/175 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108335
Panther 1 1.100 - - LDO PTHR16284
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4870
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.