DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3760 and F42A10.5

DIOPT Version :9

Sequence 1:NP_726501.1 Gene:CG3760 / 37987 FlyBaseID:FBgn0022343 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_498338.1 Gene:F42A10.5 / 175872 WormBaseID:WBGene00018341 Length:272 Species:Caenorhabditis elegans


Alignment Length:251 Identity:63/251 - (25%)
Similarity:100/251 - (39%) Gaps:69/251 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELDDFFAKKDKKKSKNKTKFVTADEMVKNLEDGTKREVVKPKKPEVAAGGVAVVGENENSGTKVP 67
            :|..|||||..||.|:..|.   :|:.:.||...||:....::.|            :.|..:|.
 Worm     4 DLSAFFAKKKDKKKKSAVKI---EEVGQALERRAKRQEEYEQESE------------DVSEKRVE 53

  Fly    68 ESA---PPVEEEWKEFEEEQRKDYSGLKIGQLSTISSARSRTAQESSESQAARVPSAPDGGNYNE 129
            |..   |..|.||.|:.|.|.: ..||||..:..          ||.:.|.           .||
 Worm    54 EEKAVNPNEESEWIEYGESQGR-LDGLKIKDMGL----------ESEQDQV-----------NNE 96

  Fly   130 DDEDSNGYDN---ADVNKERVGHGPWKKVVPAEEVMQIPVPVEVEKHSSKTYVSPALRYSQQAGS 191
            :.||...::.   ..|:.|:      |.....|:.:.|.     :|..:..|..||:|       
 Worm    97 EPEDREVHETKTWGQVSSEK------KATEEPEQAVTIS-----DKAMAAAYKPPAMR------- 143

  Fly   192 GLGGGPTGGALRPRRAAP--DITNTEFFPTLS-AARPEEQRKKKNEPAFEEVRHGS 244
                 ..|...|||.||.  |:.:...||:|: |::.|:.:|::::.....|:.||
 Worm   144 -----RPGAPYRPRAAAANLDMGSDAAFPSLADASKIEKNKKEESKSPGGWVKAGS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3760NP_726501.1 CDV3 86..223 CDD:292003 31/142 (22%)
F42A10.5NP_498338.1 CDV3 62..170 CDD:292003 36/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108335
Panther 1 1.100 - - LDO PTHR16284
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.