DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30427 and FAR8

DIOPT Version :9

Sequence 1:NP_001246512.1 Gene:CG30427 / 37986 FlyBaseID:FBgn0043792 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_190042.2 Gene:FAR8 / 823581 AraportID:AT3G44560 Length:496 Species:Arabidopsis thaliana


Alignment Length:319 Identity:87/319 - (27%)
Similarity:159/319 - (49%) Gaps:45/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRLE-EMFKLPIFQRIKD 74
            :.::|||.:|||:||:.||.:||:|....::.::.::.|....:|...||. |.|:..:|:.::|
plant     8 FLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFEKDLFKVLRD 72

  Fly    75 ERPE------MLKRVTIYQGDVTFDQLGLSGESLK-HVTENTNIVFHMAATLKLEGNLRDAIDMN 132
            ...:      :.::|....||:..|.||:...:|: .:.:..:||.::|||...:......:.:|
plant    73 NLGDEKLNTLLSEKVVPVAGDIAMDHLGMKDSNLRERMQKEIDIVVNVAATTNFDERYDIGLGIN 137

  Fly   133 LLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQDVMYEKVYEFPHKP------------------- 178
            ..|....||.||:..:.:..:|:|||:      |..||....|.||                   
plant   138 TFGALNVLNFAKKCVKAQLLLHVSTAY------VCGEKPGLLPEKPFVMEEICNENGLQLDINLE 196

  Fly   179 EDLM--RLAEWMDVKTLDAITPDLLKP--------H--PNTYTYSKRLAELLVRDHYESMPVIIA 231
            .:||  ||.|..:....:..|...:|.        |  ||||.::|.:.|:|:.:|.|::|::|.
plant   197 RELMKQRLKELNEQGCSEEGTTFYMKELGMERAKLHGWPNTYVFTKSMGEMLLGNHKENLPLVII 261

  Fly   232 RPSIVTPAVAEPLPGWVDNMNGPTGVLIGAGKGVIRSMICNGELKSEVIPVDIAINGLI 290
            ||:::|..:.||.|||::.:.....|:|..||||::..:.:.....::||.|:..|.:|
plant   262 RPTMITSTLFEPFPGWIEGLRTVDSVIIAYGKGVLKCFLVDVNSVCDMIPADMVANAMI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30427NP_001246512.1 FAR-N_SDR_e 15..321 CDD:187547 87/315 (28%)
Sterile 364..453 CDD:281068
FAR8NP_190042.2 PLN02996 1..495 CDD:215538 87/319 (27%)
FAR-N_SDR_e 12..362 CDD:187547 87/315 (28%)
Sterile 394..495 CDD:281068
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 159 1.000 Domainoid score I1277
eggNOG 1 0.900 - - E1_COG3320
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I1437
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D815047at2759
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 1 1.000 - - mtm964
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11011
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X145
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.