DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30427 and SPCC162.02c

DIOPT Version :9

Sequence 1:NP_001246512.1 Gene:CG30427 / 37986 FlyBaseID:FBgn0043792 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_588242.1 Gene:SPCC162.02c / 2538929 PomBaseID:SPCC162.02c Length:981 Species:Schizosaccharomyces pombe


Alignment Length:236 Identity:51/236 - (21%)
Similarity:89/236 - (37%) Gaps:51/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VDLSPVQEYYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRLEEMFKLP 67
            :.:.|....|    ..:|||:|:.|:..||.|:     ...:.::|. .|..:.|...|.:..|.
pombe   637 LSILPTNGQY----FLLTGATGYFGRRFLEYLV-----KLNISVVCL-VRESSDEAAKERLISLV 691

  Fly    68 IFQRIKDERPEMLKRVTIYQGDVTFDQLGLSGESLKHVTENTNIVFHMAATLKLEGNLRDAIDMN 132
            ...||..|      .:.::...|...:.||.....:.:.||.:.::||||.:....:.::....|
pombe   692 PSLRISSE------NIIVWAAHVEEIRFGLDDAKWEFLVENVSRIYHMAAEVHWMKSYQELRPAN 750

  Fly   133 LLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQDVMYEKVYEFPHKPEDLMRLAEWMDVKTLDAIT 197
            :|||:..|.::                      ||..|...|       :......:|:..|   
pombe   751 VLGTKTVLELS----------------------VMGPKALYF-------ISGGGQQEVELDD--- 783

  Fly   198 PDLLKPHPNTYTYSKRLAELLVRDHYE-SMPVI-IARPSIV 236
             |......:.|..||.:||||.|...: ..|:| :.||..:
pombe   784 -DTQSAKASGYALSKYVAELLCRKISDLGHPLIYVIRPGFI 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30427NP_001246512.1 FAR-N_SDR_e 15..321 CDD:187547 49/224 (22%)
Sterile 364..453 CDD:281068
SPCC162.02cNP_588242.1 CaiC 16..514 CDD:223395
AFD_class_I 44..518 CDD:302604
SDR_e1 646..912 CDD:187546 50/227 (22%)
Lys2b 647..981 CDD:225857 49/222 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3369
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.