DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pain and ANKRD36B

DIOPT Version :10

Sequence 1:NP_611979.1 Gene:pain / 37985 FlyBaseID:FBgn0060296 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_079466.3 Gene:ANKRD36B / 57730 HGNCID:29333 Length:1353 Species:Homo sapiens


Alignment Length:485 Identity:103/485 - (21%)
Similarity:168/485 - (34%) Gaps:121/485 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YINKKLDKAAISYAADSRDPGNLA----ALLKYRPGNKVQVDRK----------YGQLTPLNSLA 123
            |..|::.:|.:.        |||.    .||.|...||  .|||          .||...::.|.
Human    19 YHLKRIHRAVLR--------GNLEKLKYLLLTYYDANK--RDRKERTALHLACATGQPEMVHLLV 73

  Fly   124 K-----NLTD--ENAPDV-------YSCMQLLLDYGASPNIVDQGEFTPLHHVLRKSKVKAGKKE 174
            .     ||.|  :..|.:       .:|..|||..||.|||.|....|.||:.:.....     .
Human    74 SRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDT-----S 133

  Fly   175 LIQLFLDHPELDIDSYRNGEVRRLLQA------QFPELKLPEERHTGPEIDIQTLQRTLRDGDET 233
            :|:..|.| ..:|:.....|.:.||.|      :..|..|.::.:...   |..|.|:......|
Human   134 MIEKLLSH-GTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNA---IDYLGRSALILAVT 194

  Fly   234 LFEQQFAEYLQNLKGGADNQLNAHQEEYFGLLQESIKRGRQR--AFDVILS------TGMDINSR 290
            |.|:.....|      ..:.::....:.:|.|.|......:.  .||:|..      ..:.|||.
Human   195 LGEKDIVILL------LQHNIDVFSRDVYGKLAEDYASEAENRVIFDLIYEYKRKRYEDLPINSN 253

  Fly   291 P-----GRANEA--------NLVETAVIYGNWQALERLLKEPNLRLTPDSK-LLNAVIGRLDEPP 341
            |     .||.:|        :.:.|.:..|.........|:|..:.|.|.| .::.:...:.|..
Human   254 PVSPQKQRAEKATSDDKDSVSNIATEIKEGPISGTVSSQKQPAEKATSDEKDSVSNIATEIKEGQ 318

  Fly   342 YDG--SSHQRCFELLINSDRVD-INEAD-----------SGRLVPLFFAVKYRNTSAMQKL--LK 390
            ..|  |..::..:.:|...:|. :|.|.           |.:..|.......:..||:...  :|
Human   319 QSGTVSPQKQSAQKVIFKKKVSLLNIATRIMGGGKSGTVSSQKQPASKTASDKTDSALNTATEIK 383

  Fly   391 NGAYIGSKSAFGTLPIKDMPPEVLEEHFDSCITT---NGERPG--------------DQNFEIII 438
            :|...|:.|:.....:|....   ||...|.|.|   :||:.|              |:.    .
Human   384 DGLQCGTVSSQKQQALKATTD---EEGSVSNIATEIKDGEKSGTVSSQKKPALKATSDEK----D 441

  Fly   439 DYKNLMRQERDSGLNQLQDEMAPIAFIAES 468
            .:.|:.|:::|..:::......|.|..|.|
Human   442 SFSNITREKKDGEISRTVSSQKPPALKATS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
painNP_611979.1 ANKYR 2..>182 CDD:440430 36/136 (26%)
ANK repeat 82..111 CDD:293786 8/32 (25%)
ANK repeat 113..152 CDD:293786 16/52 (31%)
ANKYR <243..>406 CDD:440430 36/200 (18%)
ANK repeat 324..366 CDD:293786 9/45 (20%)
ANK repeat 368..393 CDD:293786 4/26 (15%)
Ion_trans 495..746 CDD:459842
ANKRD36BNP_079466.3 ANK 1 19..48 9/36 (25%)
ANKYR 24..248 CDD:440430 55/248 (22%)
ANK repeat 24..50 CDD:293786 9/35 (26%)
ANK 2 52..81 4/28 (14%)
ANK repeat 54..83 CDD:293786 5/28 (18%)
ANK repeat 85..116 CDD:293786 10/30 (33%)
ANK 3 85..114 8/28 (29%)
ANK 4 118..147 7/34 (21%)
ANK repeat 118..142 CDD:293786 6/29 (21%)
ANK repeat 151..182 CDD:293786 6/33 (18%)
ANK 5 151..180 6/28 (21%)
ANK repeat 184..215 CDD:293786 6/36 (17%)
ANK 6 184..213 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..307 14/57 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..607 25/130 (19%)
CCDC158 712..>1342 CDD:464943
CCDC144C 949..1239 CDD:464371
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.