DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pain and ANKRD36B

DIOPT Version :9

Sequence 1:NP_611979.1 Gene:pain / 37985 FlyBaseID:FBgn0060296 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_001380868.1 Gene:ANKRD36B / 57730 HGNCID:29333 Length:1353 Species:Homo sapiens


Alignment Length:485 Identity:103/485 - (21%)
Similarity:168/485 - (34%) Gaps:121/485 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YINKKLDKAAISYAADSRDPGNLA----ALLKYRPGNKVQVDRK----------YGQLTPLNSLA 123
            |..|::.:|.:.        |||.    .||.|...||  .|||          .||...::.|.
Human    19 YHLKRIHRAVLR--------GNLEKLKYLLLTYYDANK--RDRKERTALHLACATGQPEMVHLLV 73

  Fly   124 K-----NLTD--ENAPDV-------YSCMQLLLDYGASPNIVDQGEFTPLHHVLRKSKVKAGKKE 174
            .     ||.|  :..|.:       .:|..|||..||.|||.|....|.||:.:.....     .
Human    74 SRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDT-----S 133

  Fly   175 LIQLFLDHPELDIDSYRNGEVRRLLQA------QFPELKLPEERHTGPEIDIQTLQRTLRDGDET 233
            :|:..|.| ..:|:.....|.:.||.|      :..|..|.::.:...   |..|.|:......|
Human   134 MIEKLLSH-GTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNA---IDYLGRSALILAVT 194

  Fly   234 LFEQQFAEYLQNLKGGADNQLNAHQEEYFGLLQESIKRGRQR--AFDVILS------TGMDINSR 290
            |.|:.....|      ..:.::....:.:|.|.|......:.  .||:|..      ..:.|||.
Human   195 LGEKDIVILL------LQHNIDVFSRDVYGKLAEDYASEAENRVIFDLIYEYKRKRYEDLPINSN 253

  Fly   291 P-----GRANEA--------NLVETAVIYGNWQALERLLKEPNLRLTPDSK-LLNAVIGRLDEPP 341
            |     .||.:|        :.:.|.:..|.........|:|..:.|.|.| .::.:...:.|..
Human   254 PVSPQKQRAEKATSDDKDSVSNIATEIKEGPISGTVSSQKQPAEKATSDEKDSVSNIATEIKEGQ 318

  Fly   342 YDG--SSHQRCFELLINSDRVD-INEAD-----------SGRLVPLFFAVKYRNTSAMQKL--LK 390
            ..|  |..::..:.:|...:|. :|.|.           |.:..|.......:..||:...  :|
Human   319 QSGTVSPQKQSAQKVIFKKKVSLLNIATRIMGGGKSGTVSSQKQPASKTASDKTDSALNTATEIK 383

  Fly   391 NGAYIGSKSAFGTLPIKDMPPEVLEEHFDSCITT---NGERPG--------------DQNFEIII 438
            :|...|:.|:.....:|....   ||...|.|.|   :||:.|              |:.    .
Human   384 DGLQCGTVSSQKQQALKATTD---EEGSVSNIATEIKDGEKSGTVSSQKKPALKATSDEK----D 441

  Fly   439 DYKNLMRQERDSGLNQLQDEMAPIAFIAES 468
            .:.|:.|:::|..:::......|.|..|.|
Human   442 SFSNITREKKDGEISRTVSSQKPPALKATS 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
painNP_611979.1 ANK 56..180 CDD:238125 35/134 (26%)
ANK repeat 82..111 CDD:293786 8/32 (25%)
ANK repeat 113..152 CDD:293786 16/52 (31%)
ANK 303..406 CDD:238125 21/119 (18%)
Ank_2 303..398 CDD:289560 20/111 (18%)
ANK repeat 324..366 CDD:293786 9/45 (20%)
ANK repeat 368..393 CDD:293786 4/26 (15%)
Ion_trans 525..746 CDD:278921
ANKRD36BNP_001380868.1 ANKYR 17..209 CDD:223738 51/214 (24%)
ANK 1 19..48 9/36 (25%)
Ank_2 24..116 CDD:403870 28/101 (28%)
ANK repeat 24..50 CDD:293786 9/35 (26%)
ANK 2 52..81 4/28 (14%)
ANK repeat 54..83 CDD:293786 5/28 (18%)
ANK repeat 85..116 CDD:293786 10/30 (33%)
ANK 3 85..114 8/28 (29%)
ANK 4 118..147 7/34 (21%)
ANK repeat 118..142 CDD:293786 6/29 (21%)
ANK repeat 151..182 CDD:293786 6/33 (18%)
ANK 5 151..180 6/28 (21%)
ANK repeat 184..215 CDD:293786 6/36 (17%)
ANK 6 184..213 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..307 14/57 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..607 25/130 (19%)
CCDC158 712..>1342 CDD:318193
CCDC144C 949..1240 CDD:405585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.