DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pain and ANKRD36C

DIOPT Version :9

Sequence 1:NP_611979.1 Gene:pain / 37985 FlyBaseID:FBgn0060296 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_001297083.1 Gene:ANKRD36C / 400986 HGNCID:32946 Length:2144 Species:Homo sapiens


Alignment Length:446 Identity:88/446 - (19%)
Similarity:141/446 - (31%) Gaps:166/446 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 INK--KLDKAAISYAADSRDPGNLAALLKYRPGNKVQVDRKYGQLTPL------------NSLAK 124
            |||  :.::.|:..|..:..| .:..||..|.......||:  ..|||            ..|.:
Human    58 INKRDRKERTALHLACATGQP-EMVHLLVSRRCELNLCDRE--DRTPLIKAVQLRQEACATLLLQ 119

  Fly   125 NLTDENAPDVY--------------SCMQLLLDYGASPNIVDQGEFTPLHHVLRKSKVK------ 169
            |..|.|..||:              |.::.||.|||:.....:.|:.||...:.:.|||      
Human   120 NGADPNITDVFGRTALHYAVYNEDTSMIEKLLSYGANIEECSEDEYPPLFLAVSQRKVKMVEFLL 184

  Fly   170 ----------------------AGKKELIQLFLDHPELDIDSYRNGEVRRLLQAQFPELKLPEER 212
                                  .|:|:::.|.|.|   :||.:......:|.:....|.|     
Human   185 KKKANINAVDYLGRSALIHAVTLGEKDIVILLLQH---NIDVFSRDVYGKLAEDYASEAK----- 241

  Fly   213 HTGPEIDIQTLQRTLRDGDETLFEQQFAEYLQNLKGGADNQLNAHQEEYFGLLQESIKRGRQRAF 277
                              :..:||..: ||          :...|:|                  
Human   242 ------------------NRVIFELIY-EY----------ERKKHEE------------------ 259

  Fly   278 DVILSTGMDINSRP-------------GRANEANLVETAVIYGNWQALERLLKEPNLRLTPD--S 327
                   :.|||.|             |:.:..:.:.|.:..|.........|:|.|:.|.|  .
Human   260 -------LSINSNPVSSQKQPALKATSGKEDSISNIATEIKDGQKSGTVSSQKQPALKGTSDKND 317

  Fly   328 KLLNAVIGRLDEPPYDGSSHQRCFELLINSDRVDI---------NEADSGRLVPLFFAVK----- 378
            .:.|......||......|.|:...|...||:.|.         :|..||.::|   ||:     
Human   318 SVSNTATEIKDEQKSGTVSSQKQPALKDTSDKNDSVSNTATEIKDEQKSGTVLP---AVEQCLNR 379

  Fly   379 --YR----------NTSAMQKLLKNGAYIGSKSAFGTLPIKDMPPEVLEEHFDSCI 422
              ||          :..|::..:.:..||..:.......|:|:.|.| ||..|.|:
Human   380 SLYRPDAVAQPVTEDEFALESEIISKLYIPKRKIISPRSIEDVLPPV-EEAVDRCL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
painNP_611979.1 ANK 56..180 CDD:238125 35/161 (22%)
ANK repeat 82..111 CDD:293786 6/28 (21%)
ANK repeat 113..152 CDD:293786 15/64 (23%)
ANK 303..406 CDD:238125 26/130 (20%)
Ank_2 303..398 CDD:289560 26/122 (21%)
ANK repeat 324..366 CDD:293786 12/52 (23%)
ANK repeat 368..393 CDD:293786 7/41 (17%)
Ion_trans 525..746 CDD:278921
ANKRD36CNP_001297083.1 Ank_4 36..85 CDD:290365 7/27 (26%)
ANK repeat 36..62 CDD:293786 3/3 (100%)
ANK 59..184 CDD:238125 31/127 (24%)
ANK repeat 66..95 CDD:293786 6/29 (21%)
Ank_2 69..157 CDD:289560 22/90 (24%)
ANK repeat 97..128 CDD:293786 7/32 (22%)
ANK 125..249 CDD:238125 27/149 (18%)
ANK repeat 130..158 CDD:293786 6/27 (22%)
Ank_2 135..227 CDD:289560 19/94 (20%)
ANK repeat 163..194 CDD:293786 6/30 (20%)
ANK repeat 196..227 CDD:293786 7/33 (21%)
KASH_CCD 1620..1819 CDD:291334
CCDC144C 1740..2030 CDD:291576
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.