DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and MRX21

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_015336.1 Gene:MRX21 / 856121 SGDID:S000006215 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:89/308 - (28%)
Similarity:150/308 - (48%) Gaps:36/308 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSG 78
            :.||:|||.:||:..|.:.:||..|:| ...|::.    ||:..:.:.||.|||.:|:|||:...
Yeast    27 LAGGVAGAVSRTVVSPFERVKILLQVQ-SSTTSYN----RGIFSSIRQVYHEEGTKGLFRGNGLN 86

  Fly    79 QVLSISYALVQFWSYEQL-RSMAH------QFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVR 136
            .:....|:.|||..||.. :.:.|      |......:......:|||.:    .||..|.|:::
Yeast    87 CIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCS----VVATYPLDLIK 147

  Fly   137 TQM---VAADPSSRRSQMNTFTG-------LRKVYKMEGWM-GLSRGLPFTLVQVFPLVGANFLF 190
            |::   .|...|..||:..:.:.       |.:.|::||.: ||.||:..|.:.|.|.|..||..
Yeast   148 TRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAV 212

  Fly   191 YKYLNAAVLMAK--PPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFG 253
            |:.|....:.:.  .|..:..::...:   ||:||.:|:.|.||.|||::|.|::|.......| 
Yeast   213 YEQLREFGVNSSDAQPSWKSNLYKLTI---GAISGGVAQTITYPFDLLRRRFQVLAMGGNELGF- 273

  Fly   254 RNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDM 301
               ...::...:.|..|.||:.|:|||:...|.|....:||.:.:|::
Yeast   274 ---RYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 84/299 (28%)
Mito_carr 23..99 CDD:278578 25/76 (33%)
Mito_carr 108..194 CDD:278578 27/96 (28%)
Mito_carr 216..307 CDD:278578 28/86 (33%)
MRX21NP_015336.1 PTZ00169 26..304 CDD:240302 85/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I2407
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.