DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and TPC1

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_011610.3 Gene:TPC1 / 852988 SGDID:S000003328 Length:314 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:84/318 - (26%)
Similarity:153/318 - (48%) Gaps:51/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHK--GSKYRGVIHAFKSVYAEEGMRGMFRGHN 76
            :.|.::|...|:||.|:|.:|||  :|:.|....|  ||:   |:...:|:...||:|..::|:.
Yeast    21 LAGAVSGLLARSITAPMDTIKIR--LQLTPANGLKPFGSQ---VMEVARSMIKNEGIRSFWKGNI 80

  Fly    77 SGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPF-----LMFFICGGIAGCLGAVAAQPFDVVR 136
            .|.:|.::|...||.||    |:.:::    ..||     |...:.|..||...::.:.||||:|
Yeast    81 PGSLLYVTYGSAQFSSY----SLFNRY----LTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLR 137

  Fly   137 TQMVAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMA 201
            |::||   :::...|:....:|.::|:||..|..:|...::..:  .:.|:.:|..|....:.. 
Yeast   138 TRLVA---NNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTI--TLTASIMFGTYETIRIYC- 196

  Fly   202 KPPDQRQEIHGA-----FLFLN---GALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPEC 258
               |:.::...|     ...||   |.:.||:||:|.:|.:.:::|:|.|..|...| |.|:   
Yeast   197 ---DENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEK-FSRH--- 254

  Fly   259 PTILGCI---------TTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHYI 307
            .::.|..         ....::||:...|:|:|..|.|....:.|.|..|:. ..||:
Yeast   255 SSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYET-AIHYL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 80/304 (26%)
Mito_carr 23..99 CDD:278578 26/77 (34%)
Mito_carr 108..194 CDD:278578 23/90 (26%)
Mito_carr 216..307 CDD:278578 28/102 (27%)
TPC1NP_011610.3 Mito_carr 16..105 CDD:395101 29/96 (30%)
PTZ00169 21..285 CDD:240302 75/289 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341940
Domainoid 1 1.000 53 1.000 Domainoid score I2797
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1857
OMA 1 1.010 - - QHG55227
OrthoFinder 1 1.000 - - FOG0001923
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24089
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.