DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Slc25a16

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_780403.1 Gene:Slc25a16 / 73132 MGIID:1920382 Length:332 Species:Mus musculus


Alignment Length:322 Identity:75/322 - (23%)
Similarity:146/322 - (45%) Gaps:54/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRG 74
            |...:.|||||...:|...|||.:|:..|      .:::..|:.||:...::|..:||..|:::|
Mouse    37 LRSFLAGGIAGCCAKTTVAPLDRVKVLLQ------AHNRHYKHLGVLSTLRAVPQKEGYLGLYKG 95

  Fly    75 HNSGQVLSISYALVQFWSYEQLRSM----------AHQFDYWRERPFLMFFICGGIAGCLGAVAA 129
            :.:..:....|..:||.::|..::.          .|:            .:.|.:||....:..
Mouse    96 NGAMMIRIFPYGAIQFMAFEHYKTFITTKLGVSGHVHR------------LMAGSMAGMTAVICT 148

  Fly   130 QPFDVVRTQMVAADPSSRRSQMNTFTGL----RKVYKME-GWMGLSRGLPFTLVQVFPLVGANFL 189
            .|.||||.::     :.:....:|::|:    :.:|..| |::|..|||..|::.:.|..|.:|.
Mouse   149 YPLDVVRVRL-----AFQVKGEHTYSGIIHAFKTIYAKEGGFLGFYRGLMPTILGMAPYAGVSFF 208

  Fly   190 FYKYLN------AAVLMAKPPDQRQEIHGAFLFLN---GALSGVLAKMIVYPADLLKKRIQLMAF 245
            .:..|.      |..|:.:|......:......:|   |.::|.:|:.|.||.|:.::|:||.|.
Mouse   209 TFGTLKSVGLSYAPALLGRPSSDNPNVLVLKTHINLLCGGVAGAIAQTISYPFDVTRRRMQLGAV 273

  Fly   246 KQERKTFGRNPECPTILGCITTTFREEGI-GGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY 306
            ..|.:      :|.|:...:...:.:.|| .|.|:|:....::.....||.|:.|::.|:.:
Mouse   274 LPEFE------KCLTMRETMKYVYGQHGIRRGLYRGLSLNYIRCIPSQAVAFTTYELMKQFF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 68/305 (22%)
Mito_carr 23..99 CDD:278578 18/75 (24%)
Mito_carr 108..194 CDD:278578 21/90 (23%)
Mito_carr 216..307 CDD:278578 25/95 (26%)
Slc25a16NP_780403.1 Mito_carr 33..125 CDD:278578 24/93 (26%)
Solcar 1 34..120 24/88 (27%)
PTZ00169 36..330 CDD:240302 75/322 (23%)
Solcar 2 128..216 23/104 (22%)
Mito_carr 131..214 CDD:278578 22/99 (22%)
Mito_carr 238..330 CDD:278578 25/98 (26%)
Solcar 3 238..328 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.