DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Slc25a42

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_006253013.1 Gene:Slc25a42 / 689414 RGDID:1592346 Length:329 Species:Rattus norvegicus


Alignment Length:192 Identity:58/192 - (30%)
Similarity:88/192 - (45%) Gaps:17/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSV---YAEEGMRGM 71
            |...:.|.:|||..:|...|||..||.||:         .||......||:.:   |..||...:
  Rat    79 LSSLLSGALAGALAKTAVAPLDRTKIIFQV---------SSKRFSAKEAFRLLYFTYLNEGFLSL 134

  Fly    72 FRGHNSGQVLSISYALVQFWSYEQL-RSMAHQFDYWRER-PFLMFFICGGIAGCLGAVAAQPFDV 134
            :||:::..|..|.||.:||.::|:. |.:.|.:.:..|. |.....:.|.:||...|....|.|:
  Rat   135 WRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAGTTAASLTYPLDL 199

  Fly   135 VRTQMVAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNA 196
            ||.:| |..|....|  |.|....::.:.||...|..|...|::.|.|..|.:|..|:.|.:
  Rat   200 VRARM-AVTPKEMYS--NIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 53/179 (30%)
Mito_carr 23..99 CDD:278578 25/79 (32%)
Mito_carr 108..194 CDD:278578 26/86 (30%)
Mito_carr 216..307 CDD:278578
Slc25a42XP_006253013.1 Mito_carr 74..167 CDD:278578 31/96 (32%)
Mito_carr <192..259 CDD:278578 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.