DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and CG7943

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:302 Identity:69/302 - (22%)
Similarity:122/302 - (40%) Gaps:45/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GAATRTITQPLDVLKIRFQMQVE--PVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRG---HNSGQ 79
            |||...|.....:.|:.|:..:.  |:|:           ||..: ..||:..::||   ..:.:
  Fly    62 GAAFVNIAVTYPIYKMIFRQMLHGVPITS-----------AFAQL-RHEGLGFLYRGMLPPLAQK 114

  Fly    80 VLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQMVAADP 144
            .:|:|   :.|..::..|....: || |...:....:...:||...::.. ||:  |.|.:.||.
  Fly   115 TISLS---IMFGVFDGTRRYLVE-DY-RLNDYGAKVLAAVVAGSAESILL-PFE--RVQTLLADS 171

  Fly   145 SSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVG-ANFLFYKYLNAAVLMAKPPDQRQ 208
            ...:...||....|.|....|:..|.|||.    .||...| :|.||: .|.....:..|..:..
  Fly   172 KFHQHFSNTQNAFRYVVSHHGYRELYRGLE----PVFWRNGLSNALFF-VLREEASVRLPKRKSV 231

  Fly   209 EIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEG 273
            .......|:.||:.|.....|.||.:::|..:|   .:..:::.|....|..|.     ..|:..
  Fly   232 STRTVQEFIAGAVIGASISTIFYPLNVIKVSLQ---SEMGQRSEGSWQACKRIY-----VERDRR 288

  Fly   274 IGGFYKGMLP-----TLLKAGLMSAVYFSIYDMFKRHYIAPM 310
            ||.||:| .|     :.:..|:|:..|.::..:.::....|:
  Fly   289 IGNFYRG-CPFNTGRSFISWGIMNTAYENLKKLMQQQPPLPL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 65/291 (22%)
Mito_carr 23..99 CDD:278578 15/80 (19%)
Mito_carr 108..194 CDD:278578 23/86 (27%)
Mito_carr 216..307 CDD:278578 22/95 (23%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/89 (20%)
Mito_carr 141..229 CDD:278578 25/95 (26%)
Mito_carr 235..322 CDD:278578 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.