DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and mfrn

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:316 Identity:76/316 - (24%)
Similarity:124/316 - (39%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPENSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAE 65
            :|..||.|.:   ..|.|||.....:..|||.:|.|.|....|..|      ..::...:::...
  Fly     9 LPTTSVGVNM---TAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKN------MNIVSTLRTMITR 64

  Fly    66 EGMRGMFRGHNSGQVLSISYA-LVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAA 129
            ||:....|| .|..||....| .:.|.:||..:.:..:|...|.   |.:.|.|.:|..:....:
  Fly    65 EGLLRPIRG-ASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRN---LNYVISGAVATLIHDAIS 125

  Fly   130 QPFDVVRTQMVAADPSSRRSQM--NTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGANF 188
            .|.||::          :|.||  :.:|.    :|.:||.||:....|.....||...|....:|
  Fly   126 SPTDVIK----------QRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHF 180

  Fly   189 LFYKYLNAAVLMAK---PPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERK 250
            ..|::....:.:.:   ||     :|.|    .||.:|..|..:..|.|::             |
  Fly   181 TTYEFFQNKMNLERKYNPP-----VHMA----AGAAAGACAAAVTTPLDVI-------------K 223

  Fly   251 TFGRNPECPTILGCITTT---FREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFK 303
            |.....|.....|.|..:   :...|..||::|....:|.:...:|:.:|.|:.||
  Fly   224 TLLNTQETGLTRGMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 68/294 (23%)
Mito_carr 23..99 CDD:278578 19/76 (25%)
Mito_carr 108..194 CDD:278578 22/91 (24%)
Mito_carr 216..307 CDD:278578 21/91 (23%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 26/94 (28%)
PTZ00168 17..280 CDD:185494 72/308 (23%)
Mito_carr 107..190 CDD:278578 22/95 (23%)
Mito_carr <215..282 CDD:278578 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.