DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and CG4743

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:329 Identity:76/329 - (23%)
Similarity:126/329 - (38%) Gaps:82/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVVVQLMQ----------AVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAF 59
            ||.:::.:          .|.||:||........|:|.:|.|.|.::                  
  Fly    13 SVAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQSEL------------------ 59

  Fly    60 KSVYAEEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGG--IAG 122
             ..:...|.||:::|.......|...|.:.|.:||..:.........::.|::.......  :..
  Fly    60 -GFWRAGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLA 123

  Fly   123 CLGAVAAQPFDVVRTQMVAADPSSRRSQMNTFTGLR---KVYKMEGW-MGLSRG--------LPF 175
            ||          :|..:..|...|:..|.|..:||:   :.|:.||. .||.||        :||
  Fly   124 CL----------IRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPF 178

  Fly   176 TLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHG-----AFLFLNGALSGVLAKMIVYPADL 235
            :|:| |||       ::|...         |...:.|     ..:.|.||::|.::..:..|.|:
  Fly   179 SLIQ-FPL-------WEYFKL---------QWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDV 226

  Fly   236 LKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300
            :|.||.|    .||::..|......||..|   :.|.|..|.:.|.:|.:|...|..|.:|..||
  Fly   227 VKTRIML----AERESLNRRRSARRILHGI---YLERGFSGLFAGFVPRVLWITLGGAFFFGFYD 284

  Fly   301 MFKR 304
            :..|
  Fly   285 LTTR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 68/299 (23%)
Mito_carr 23..99 CDD:278578 14/75 (19%)
Mito_carr 108..194 CDD:278578 24/99 (24%)
Mito_carr 216..307 CDD:278578 28/89 (31%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 19/94 (20%)
PTZ00168 25..281 CDD:185494 70/308 (23%)
Mito_carr 199..291 CDD:278578 28/97 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.