DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and GC2

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:321 Identity:90/321 - (28%)
Similarity:137/321 - (42%) Gaps:76/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQ-VEPVTNHKGSK-YRGVIHAFKSVYAEEGMRGMFRGHN 76
            :.||:||........|||::|.|.|.| :.|    .|.: |..:...|:...|.||..||:||..
  Fly    25 INGGVAGIIGVACVYPLDMVKTRLQNQTIGP----NGERMYTSIADCFRKTIASEGYFGMYRGSA 85

  Fly    77 SGQVL-----SISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVR 136
            ...||     :|......|:.|       |........|.....:.||:||....|...|.::::
  Fly    86 VNIVLITPEKAIKLTANDFFRY-------HLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLK 143

  Fly   137 TQM------VAADPSSRRSQMNTFT--GLRK----------VYKMEGWMGLSRGLPFTLVQVFPL 183
            .||      .|||.::.| ::.|.|  ||.|          :||..|..|: |.:.|::| .|||
  Fly   144 IQMQDAGRVAAADRAAGR-EVKTITALGLTKTLLRERGIFGLYKGVGATGV-RDITFSMV-YFPL 205

  Fly   184 VGANFLFYKYLNAAVLMAKPPDQ---RQEIHGAFLF----LNGALSGVLAKMIVYPADLLKKRIQ 241
            :.       ::|         ||   :.:..|..:|    :.|.|||:.:..:|.|.|::|.|:|
  Fly   206 MA-------WIN---------DQGPRKSDGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQ 254

  Fly   242 LMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMF 302
            .   ..|:|..|       |:.|:..|.:||||..|:||.|..:    ::.|..|.|..||
  Fly   255 A---DGEKKFKG-------IMDCVNRTLKEEGISAFFKGGLCRI----MVLAPLFGIAQMF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 86/312 (28%)
Mito_carr 23..99 CDD:278578 23/82 (28%)
Mito_carr 108..194 CDD:278578 28/103 (27%)
Mito_carr 216..307 CDD:278578 30/91 (33%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 85/307 (28%)
Mito_carr 16..106 CDD:278578 26/84 (31%)
Mito_carr 123..203 CDD:278578 24/82 (29%)
Mito_carr 228..302 CDD:278578 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.