DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and GC1

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:331 Identity:91/331 - (27%)
Similarity:141/331 - (42%) Gaps:72/331 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PENSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQ-MQVEPVTNHKGSK-YRGVIHAFKSVYA 64
            |::.....|.:.:.|||||....|...|||::|.|.| .|:.|    .|.: |..:...|:..|.
  Fly    14 PQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGP----NGERMYNSMFDCFRKTYK 74

  Fly    65 EEGMRGMFRGHNSG-QVLSISYALVQFWSYEQLRSMAHQFDYWRER--------PFLMFFICGGI 120
            .||..||:||  || .:|.|:       ..:.::..|:  ||:|.:        |.....:.||:
  Fly    75 AEGYFGMYRG--SGVNILLIT-------PEKAIKLTAN--DYFRHKLTTKDGKLPLTSQMVAGGL 128

  Fly   121 AGCLGAVAAQPFDVVRTQM-----VAA------------DPSSRRSQMNTFTGLRKVYKMEGWMG 168
            ||....:...|.::::.||     |||            ..:...||:....|:..:||..|..|
  Fly   129 AGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATG 193

  Fly   169 LSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFL----FLNGALSGVLAKMI 229
            | |.:.|::: .|||.            |.|....| :|.:..|..:    ||.|..:|..|.:.
  Fly   194 L-RDVTFSII-YFPLF------------ATLNDLGP-RRNDGSGEAVFWCSFLAGLAAGSTAALA 243

  Fly   230 VYPADLLKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKA----GL 290
            |.|.|::|.|:|.:     :|..|.. |...|..|||.|.:.||...|:||.|..::..    |:
  Fly   244 VNPFDVVKTRLQAI-----KKADGEK-EFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGI 302

  Fly   291 MSAVYF 296
            ...||:
  Fly   303 AQTVYY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 84/310 (27%)
Mito_carr 23..99 CDD:278578 23/78 (29%)
Mito_carr 108..194 CDD:278578 24/110 (22%)
Mito_carr 216..307 CDD:278578 28/85 (33%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 27/91 (30%)
Mito_carr 115..213 CDD:278578 26/111 (23%)
Mito_carr 226..307 CDD:278578 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.