DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Dic4

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:305 Identity:61/305 - (20%)
Similarity:122/305 - (40%) Gaps:53/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQV 80
            ||.|.........|:|::|...|:|         .:.|.::...|.:::.:|..|.:.|.::..:
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ---------RQKRSILGTVKRIHSLKGYLGFYDGFSAAIL 81

  Fly    81 LSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQM---VAA 142
            ..::...:.|..|:..:.|    :|.....:|...|.|.:||..|:....|.|::..:|   :..
  Fly    82 RQMTSTNIHFIVYDTGKKM----EYVDRDSYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142

  Fly   143 DPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQR 207
            .|..||:..:.|.||.::.|.|||..|.:|....:.:......:...||..:...|......:..
  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207

  Fly   208 QEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTIL-----GCITT 267
            ..:|    ||....:.:::..|.:|.|:::                      ||:     |...|
  Fly   208 LPLH----FLTSLGTSIISSAITHPLDVVR----------------------TIMMNSRPGEFRT 246

  Fly   268 TFREE------GIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY 306
            .|:..      |:.|.|:|.:||:::....:.:.|.:|:..:.|:
  Fly   247 VFQASVHMMRFGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLHF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 57/294 (19%)
Mito_carr 23..99 CDD:278578 12/75 (16%)
Mito_carr 108..194 CDD:278578 23/88 (26%)
Mito_carr 216..307 CDD:278578 19/102 (19%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 60/300 (20%)
Mito_carr 26..100 CDD:278578 15/82 (18%)
Mito_carr 104..201 CDD:278578 24/96 (25%)
Mito_carr 211..292 CDD:278578 20/107 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.