DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Mpcp2

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:308 Identity:70/308 - (22%)
Similarity:127/308 - (41%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSG 78
            :||.::...|.|...|||::|.|.|:.        .:||:.::|.||...||||.||:.:|....
  Fly    67 IGGILSCGTTHTFVVPLDLVKCRLQVD--------QAKYKNLVHGFKVTVAEEGARGLAKGWFPT 123

  Fly    79 QVLSISYALVQFWSYEQLRSMAHQFDYWRERPFL----MFFICGGIAGCLGAVAAQPFDV--VRT 137
            .:...:..|.:|..|| |..:.:......|..:|    ::......|.....:|..||:.  |:.
  Fly   124 LLGYSAQGLCKFGLYE-LFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKI 187

  Fly   138 QMVAADPSSRRSQMNTFTGLRKVYKMEG-----------WMGLSRGLPFTLVQVFPLVGANFLFY 191
            |.:....::.|.      .:.|:.|.||           ||   |.:|:|:::.........|.|
  Fly   188 QTIPGYANNFRE------AVPKMLKEEGVNAFYKGLVPLWM---RQIPYTMMKFACFERTVELLY 243

  Fly   192 KYLNAAVLMAKP-PDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRN 255
            ||     ::.|| .|..:.......|..|.::||...::.:|||::..::        .:..|.:
  Fly   244 KY-----VVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKL--------NQAKGAS 295

  Fly   256 PECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFK 303
                     ..:..:..|..|.:.|:.|.::..|.::|:.:.|||..|
  Fly   296 ---------AISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 68/299 (23%)
Mito_carr 23..99 CDD:278578 25/75 (33%)
Mito_carr 108..194 CDD:278578 21/102 (21%)
Mito_carr 216..307 CDD:278578 18/88 (20%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 27/83 (33%)
Mito_carr <175..245 CDD:278578 17/78 (22%)
Mito_carr 260..338 CDD:278578 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.