DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Bmcp

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:319 Identity:71/319 - (22%)
Similarity:131/319 - (41%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQVEPV-TNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNS 77
            |.||:|.......|.|:|..|.|.|:|.:.: .:....:|||:..||..:..|||:|.::.|...
  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75

  Fly    78 GQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLM----------FFICGGIAGCLGAVAAQPF 132
            ..:...:|..::|.:|..|:.:|:      ||..|:          ..:|...||.:.:..|.|.
  Fly    76 AVLRQATYGTIKFGTYYTLKKLAN------ERGLLINEDGSERVWSNILCAAAAGAISSAIANPT 134

  Fly   133 DVVRTQMVAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKYLNAA 197
            ||::.:|........:..:..|   .::||.||..||.||:..|..:...:.......|.:....
  Fly   135 DVLKVRMQVHGKGQHKGLLGCF---GEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQ 196

  Fly   198 VLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTI- 261
            ::.|...      |....|::..::.:.:.:...|.|:::.|:           ..:.|...|: 
  Fly   197 LMNAFGD------HVGNHFISSFIASLGSAIASTPIDVIRTRL-----------MNQRPVSITMN 244

  Fly   262 ---------------LGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRH 305
                           |.|...|.|.||:...|||.:||.::.|..:.::|..|:..|::
  Fly   245 GVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 66/307 (21%)
Mito_carr 23..99 CDD:278578 21/76 (28%)
Mito_carr 108..194 CDD:278578 22/95 (23%)
Mito_carr 216..307 CDD:278578 21/106 (20%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 25/85 (29%)
Mito_carr <132..199 CDD:278578 15/69 (22%)
Mito_carr 204..303 CDD:278578 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.