DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and CG18418

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:319 Identity:81/319 - (25%)
Similarity:133/319 - (41%) Gaps:44/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSK-YRGVIHAFKSVYAEE 66
            |...|...|:.|.||.:|.....|.||||:||.|.|     ::...|:: |:........|...|
  Fly     8 EKKTVPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQ-----ISGTLGTREYKNSFEVLSKVLKNE 67

  Fly    67 GMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRER----PFLMFFICGGI-AGCLGA 126
            |:..::.|.::|.:...:|...:...|:.      :.|::|:.    |.::..:..|| ||..||
  Fly    68 GILSLYNGLSAGLLRQATYTSAKMGVYQM------ELDWYRKNFGNYPSMVASMTMGIVAGAFGA 126

  Fly   127 VAAQPFDVVRTQMVAAD---PSSRRSQMNTFTGLRKVYKMEGWMGLSRGLPFTLVQVFPLVGANF 188
            :...|.:|...:|::.:   |..||:..|......::.|.||.:.|.||       ..|.||...
  Fly   127 MCGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRG-------CLPTVGRAM 184

  Fly   189 LFYKYLNAAVLMAKPPDQRQEIHGAF-----LFLNGAL-SGVLAKMIVYPADLLKKRIQLMAFKQ 247
            :    :| .|.:|.....:.::||..     |.|..|| ||:|..:...|.|:.|.|||.|    
  Fly   185 V----VN-MVQLASYSLMKNQLHGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQM---- 240

  Fly   248 ERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY 306
              |.....||....:..:....:.||....:||..|.|::.|..:...|...:...:.|
  Fly   241 --KVIDGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 73/295 (25%)
Mito_carr 23..99 CDD:278578 18/76 (24%)
Mito_carr 108..194 CDD:278578 23/93 (25%)
Mito_carr 216..307 CDD:278578 25/92 (27%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 26/108 (24%)
PTZ00169 18..296 CDD:240302 77/306 (25%)
Mito_carr 109..205 CDD:278578 28/107 (26%)
Mito_carr 208..300 CDD:278578 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.