DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and PMP34

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:309 Identity:70/309 - (22%)
Similarity:129/309 - (41%) Gaps:43/309 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGH 75
            :.||.|...|....:...|||.::.|.|::       :....|......|.:...||.:.::|| 
  Fly    17 VHAVSGAAGGCIAMSTFYPLDTVRSRLQLE-------EAGDVRSTRQVIKEIVLGEGFQSLYRG- 73

  Fly    76 NSGQVLS---ISYALVQFWSYEQLRSMA-------HQFDYWRERPFLMFFICGGIAGCLGAVAAQ 130
             .|.||.   || ..|.|:::..|:::|       |.        .|...:.|.|||.:..:...
  Fly    74 -LGPVLQSLCIS-NFVYFYTFHALKAVASGGSPSQHS--------ALKDLLLGSIAGIINVLTTT 128

  Fly   131 PFDVVRTQM-----VAADPSSRRSQMNTFTGLRKVYKMEGWMGLSRG-LPFTLVQVFPLVGANFL 189
            ||.||.|::     ........:...|...||:.|.:.||..||..| :|..::...|.:  .|:
  Fly   129 PFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPAL--QFM 191

  Fly   190 FYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERK---T 251
            .|:.|...::..    ...|:.....|..||::...|.::.||..|::.:.:..:.:.:.|   :
  Fly   192 MYEMLKRNIMRF----TGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTS 252

  Fly   252 FGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300
            .|..|...:.|..:.:..:.:||.|.::|:...:|:..|.:|:.|..|:
  Fly   253 AGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 66/297 (22%)
Mito_carr 23..99 CDD:278578 19/78 (24%)
Mito_carr 108..194 CDD:278578 23/91 (25%)
Mito_carr 216..307 CDD:278578 20/88 (23%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 22/88 (25%)
Mito_carr 105..202 CDD:278578 25/106 (24%)
Mito_carr 214..303 CDD:278578 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.