DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Tyler

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:411 Identity:82/411 - (19%)
Similarity:152/411 - (36%) Gaps:116/411 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMQAVGGGIAGAATRTITQPLDVLKIRFQMQ----VEPVTN------HKG--------------- 49
            :.|.|...:.|..|..:..||:|:|.|.|.|    ..|..:      |.|               
  Fly    46 MQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPK 110

  Fly    50 --------SKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVLSISYALVQFWSYEQLR-SMAHQF-- 103
                    ...||.:.||..:....|..|::.|.:...|.::...::.|.:||.:: |::|.:  
  Fly   111 PGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLV 175

  Fly   104 -DYWRER-----------------------------------PFLMFFICGGIAGCLGAVAAQPF 132
             ..:.|.                                   |:.:....|..:..:...|..|.
  Fly   176 SQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPI 240

  Fly   133 DVVRTQMVAADPSSRRSQMNTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGANFLFYKY 193
            ::||.:|        :|:..|:..    ||.:.:..|.:||.||.|.|:::..|..|..:..|:.
  Fly   241 EMVRIKM--------QSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEA 297

  Fly   194 LNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQL-----MAFKQERKTFG 253
            :..|..:.:|.       ..|.||.||:||.:|..:..|.||:....|:     :.:::.....|
  Fly   298 IKRAFSVTEPT-------FLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTG 355

  Fly   254 -----------RNPEC------PTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDM 301
                       :.|:.      |::|..:...:|.:|:.|.|.|::|.:|:.....|:..|.::.
  Fly   356 AGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEY 420

  Fly   302 FKR---HYIAPMKEAEKNRQK 319
            .|.   ||...::||...|.:
  Fly   421 SKSFFFHYNLDLQEAAYRRSQ 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 73/378 (19%)
Mito_carr 23..99 CDD:278578 22/109 (20%)
Mito_carr 108..194 CDD:278578 22/124 (18%)
Mito_carr 216..307 CDD:278578 26/115 (23%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 26/124 (21%)
Mito_carr 216..302 CDD:278578 21/93 (23%)
Mito_carr 306..429 CDD:278578 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.