DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and hpo-12

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001379467.1 Gene:hpo-12 / 36804989 WormBaseID:WBGene00016588 Length:313 Species:Caenorhabditis elegans


Alignment Length:311 Identity:108/311 - (34%)
Similarity:159/311 - (51%) Gaps:25/311 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PE--NSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYA 64
            ||  |..:.....:..|..:|..||.|.|||||||||||:|.||:...|..||:||:.:...:..
 Worm     6 PEAINEPLTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITR 70

  Fly    65 EEGMRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQF---DYWRERPFLMFFICGGIAGCLGA 126
            |||....::||...|.||.:|.||||.|:|.|...|.:.   |....|. ...|.||.::|||..
 Worm    71 EEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQSVRS-TSDFACGALSGCLAM 134

  Fly   127 VAAQPFDVVRTQMVAADPSSRRSQMNTFTG----LRKVYKMEGWMGLSRGLPFTLVQVFPLVGAN 187
            .||.|.||:||::||     :::....:||    ::.:::.||..|..||...::||:.|..|..
 Worm   135 TAAMPLDVIRTRLVA-----QKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQ 194

  Fly   188 FLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTF 252
            |..|.     ..|...|....|..|| || :||::|.:||.::||.|:::.|:|:..|  ||..|
 Worm   195 FALYN-----CFMDLWPFNGYESAGA-LF-SGAMAGTVAKTVLYPLDMVRHRLQMNGF--ERAGF 250

  Fly   253 GRNPE-CPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMF 302
            |:... ...:...|....:.|...|.:||:.|:.:||...|...|..|::|
 Worm   251 GKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAANSGCAFLFYEIF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 103/288 (36%)
Mito_carr 23..99 CDD:278578 38/75 (51%)
Mito_carr 108..194 CDD:278578 29/89 (33%)
Mito_carr 216..307 CDD:278578 28/88 (32%)
hpo-12NP_001379467.1 Mito_carr 11..102 CDD:395101 39/90 (43%)
Mito_carr 115..209 CDD:395101 31/104 (30%)
Mito_carr 216..309 CDD:395101 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157400
Domainoid 1 1.000 84 1.000 Domainoid score I5266
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I2639
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55227
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001923
OrthoInspector 1 1.000 - - otm14068
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24089
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2188
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.