DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and CG18324

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:311 Identity:75/311 - (24%)
Similarity:119/311 - (38%) Gaps:54/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSK-YRGVIHAFKSVYAEEGMRGMFRG----- 74
            ||.|.......|.|:||:|.|.|:|.|........| ||.:..|...:...:|:..:.:|     
  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPAL 73

  Fly    75 -----HNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDV 134
                 .||.::...|.||    ....|::......::|.    |||  |.:.||.|...|.||.:
  Fly    74 CYQFVLNSVRLSVYSNAL----ELGYLQNADGSISFYRG----MFF--GALGGCTGTYFASPFYM 128

  Fly   135 VRTQMVAADPSS-----RRSQMNTFTGLRKVYKMEGWMG--------LSRGLPFTLVQV--FPLV 184
            ::.|..|....|     :....:....|..:|:..|..|        |:|.|..:.||:  ||..
  Fly   129 IKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKA 193

  Fly   185 GANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQER 249
            .:......::...||::              |..|..||.|..:...|.|:|..|:    :.|..
  Fly   194 KSLLKDKGWITHPVLLS--------------FCAGLSSGTLVAVANSPFDVLTTRM----YNQPV 240

  Fly   250 KTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300
            ...||......::.|.|..:|.|||.|.|||..|...::...:.:.|..::
  Fly   241 DEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 72/304 (24%)
Mito_carr 23..99 CDD:278578 21/86 (24%)
Mito_carr 108..194 CDD:278578 24/100 (24%)
Mito_carr 216..307 CDD:278578 24/85 (28%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 20/77 (26%)
PTZ00169 5..293 CDD:240302 75/311 (24%)
Mito_carr 101..201 CDD:278578 25/105 (24%)
Mito_carr 204..296 CDD:278578 26/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.