DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and CG18327

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:338 Identity:78/338 - (23%)
Similarity:127/338 - (37%) Gaps:89/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGS---KYRGVIHAFKSVYAEEGMRGMFRG--- 74
            ||:|.......|.|::|:|.|.|:|.|...  :||   .|:.|..||.:|...:|:.|:.:|   
  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAA--RGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71

  Fly    75 --------------------------HNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLM 113
                                      :|.|:   ||:|...||                      
  Fly    72 ALCFQFVINSFRLSIYTHAVEKGWVHNNKGE---ISFAKGMFW---------------------- 111

  Fly   114 FFICGGIAGCLGAVAAQPFDVVRTQM-------VAADPSSRRSQMNTFTGLRKVYKMEGWMGLSR 171
                |.:.|.:|:..|.||.:::||:       :|.....:.:.|:  ..:||:|:..|..||.|
  Fly   112 ----GALGGVVGSYCASPFFLIKTQLQAQAAKQIAVGYQHQHASMS--DAIRKIYRKNGVFGLWR 170

  Fly   172 GLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFL-FLNGALSGVLAKMIVYPADL 235
            |   :|..|.....|:.:.......|..:.|  :.....|...| |.:|..:|....:.:.|.|:
  Fly   171 G---SLANVSRATVASAVQIAVFGQAKSLLK--ENGVVTHPTILSFCSGLAAGSFVSLAITPLDV 230

  Fly   236 LKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300
            :..|:    :.|.....||.......|.|:.|..|.||:.|.|||..|..|::...|.:....:|
  Fly   231 VTTRL----YNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFD 291

  Fly   301 -------MFKRHY 306
                   .:..||
  Fly   292 ELIALREKYDLHY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 73/327 (22%)
Mito_carr 23..99 CDD:278578 25/107 (23%)
Mito_carr 108..194 CDD:278578 21/92 (23%)
Mito_carr 216..307 CDD:278578 25/98 (26%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 21/79 (27%)
PTZ00169 5..293 CDD:240302 76/325 (23%)
Mito_carr 101..201 CDD:278578 29/135 (21%)
Mito_carr 204..296 CDD:278578 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.