DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tpc2 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:315 Identity:71/315 - (22%)
Similarity:119/315 - (37%) Gaps:71/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGGGIAGAATRTITQPLDVLKIRFQMQVEPV--TNHKGSKYRGV------IHAFKSVYAEEGMRG 70
            :|..:|    .:...||||.|.|.|:..|..  |......:|..      :..|||:||      
  Fly    45 IGANLA----ESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYA------ 99

  Fly    71 MFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFL-------------MFFICGGIAG 122
                       ..|..:.:.:.:..||.:.  :|.:| ||||             |...|...||
  Fly   100 -----------GFSAMVTRNFIFNSLRVVL--YDVFR-RPFLYQNERNEEVLKIYMALGCSFTAG 150

  Fly   123 CLGAVAAQPFDVVRTQMVAADPSSRRSQM-------NTFTGLRKVYKMEG----WMGLSRGLPFT 176
            |:....|.|||:|:.:|   ....||.|:       :.......:|:..|    |.|:.......
  Fly   151 CIAQALANPFDIVKVRM---QTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRA 212

  Fly   177 LVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQ 241
            .:.....||:..:..:.....:.:.:....|        |::...:|:.|.::..|||::|.|: 
  Fly   213 CLMTTGDVGSYDISKRTFKRLLDLEEGLPLR--------FVSSMCAGLTASVLSTPADVIKSRM- 268

  Fly   242 LMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYF 296
               ..|.....|:|......|.|:....||||:...|||::||..:.|..|.:::
  Fly   269 ---MNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 69/306 (23%)
Mito_carr 23..99 CDD:278578 18/83 (22%)
Mito_carr 108..194 CDD:278578 24/109 (22%)
Mito_carr 216..307 CDD:278578 24/81 (30%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/98 (21%)
Mito_carr 137..232 CDD:278578 20/97 (21%)
Mito_carr 237..329 CDD:278578 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.